close all open/close all

CDS information : Pyrlo_00240


close this sectionLocation

Organism
StrainATCC 31673 (=NBRC 14294)
Entry namePyrrolomycin
Contig
Start / Stop / Direction37,588 / 30,893 / - [in whole cluster]
37,588 / 30,893 / - [in contig]
Locationcomplement(30893..37588) [in whole cluster]
complement(30893..37588) [in contig]
TypeCDS
Length6,696 bp (2,231 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase
Gene
Gene (GenBank)pyr24
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17158935] Cloning and characterization of the pyrrolomycin biosynthetic gene clusters from Actinosporangium vitaminophilum ATCC 31673 and Streptomyces sp. strain UC 11065. (Antimicrob Agents Chemother. , 2007)

close this sectionPKS/NRPS Module

3 malonyl-CoA
KS42..417
AT572..870
KR1454..1650
ACP1743..1816
R1868..2226

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase]
MTTTQSGPAQEYRTRLVEALRTIERLQDRLKKANDRPQRLSEPIAIVGLGCRLPGGADSP
EAFWRVLRDGVDTTSEFPAERGDASALYDPDPDAPGKAYVIRGAFLGRVDTFEPSVFGIS
PREALGMDPQQRITLEVAWEALERAGYAPDSLSGSATGVYLGLSTTDYVRMRQSEGDIRD
VDAYQLVGEPSFAAGRISYTLGLQGPSKVMDTTCSSSLVALHEACQGLRLGECDMALAGG
VNLMLSPYGFVMMSKFAGLSPEGRCKTFDASADGYARGEGCGVVVLKRYSDALRDGDNVI
ALVRGTAVNHDGRSSGLTVPNPAAQQDVIRAALAQAGIAPGDVDYVEAHGTGTALGDPIE
LRALEAVIGRNRPAGSPLLVGSVKTNIGHLESAAGVAGLLKLVLALQHGQIPPHLHFTDP
NPNVDWSRLHIEVTAQGRPWPTSDRPAIGAISSFGASGTNAHAVVSAPPAPAGNGQNGVT
RDVLVLSANTEESLTELARKYALHLRREPDLTLGDACHTTQVGRSRQSYGLAVAGDSLDS
LADALDAHLRGGRDPRVDTARLPVHKYRKTGWLFTGQGAQYAQMARGLADEPAFREAFDA
CAELFDPLLGRSLASVVWPEPGTESPIDDTRYTQPALFAVEYALARMWLGWGLKPSALLG
HSIGELAAACIAGVFSLPDAVRLVAARASLMADLPAGGAMAAVHCDEATARRAIADHPDT
LSLAAVNGPHTVTVSGVAADLDAVLATLKEQGVRSQRLTVSHAFHSPLLRPMLDEFRRVA
GTITYAAPTIPLYSNVTGQLWTAAEVGPEYWVRHAAGAVRFHDGITGLHASGVRTFLEVG
PAPVLVGMGSRAVEDPDCTWIASLRRPTRKGASLHDQDSVRQALGLLYLRGGTVDWAAVH
AGQNPRRVPLPTAVWRGDSYWFAERRKDAEAAPAPRAGTVVPSIGLRLHSAVPTYEVNLD
DARWEPYARQATDGRSYLPVGALAAVMQDAVADAFGGRWDCLEELIIDQRIPRDGDGRIV
QITLRSTSDGHATFEWHSITPDEEAAGAPWKLHGHGLLRRRASGRRLAPELQVHRYGDAV
SYEPAALSSALAGAVTGASRGGGGVLVALAPERAEGGLSWVEIVDAAVAALSWDAGVDTQ
EVGFTRRVSDLICEDPRRVAYVRATAHRTTGTSEHLHEVLGGAEFFAEDGAHIGSIGELL
VVGNKAAPAQSAPWRHPDELLQRVEWQVAPAPPSPGRLDDENWLLVPDRDGVADRLAEEL
RRRGARCLVAAPDVAGTDRAAVTELLARWRDQSVPTDTADRIVLLTGLDAPEPEAADAEA
LVEYRDRTELTVVSLVQGLLAREDCAKATVSFVTRGTMPAQRARGDVSSPFGNTLWGLGR
VVALEHPEHWGGAVDLDPAGPLTDDVARLADALLDVRAEDQQALRGDTRYVARLVPHSVT
QEELRSTPPVRSSASYLITGAFGGIGRALSRWLAINGAGKLVLVGRTPLPPRTDWDMPGL
SQAVRERIDLVRELEATGALVEVAAADVCDPAQLLPVMEDLAVDSRPLAGVVHAAGLSVP
QFLRDITVETPDDYDAVWRPKVVGGWLLHQLTEGAELDFFLGFSSIAATWGSQHLSSYSA
SNAFLDGLAEYRRGLGQAALTVSWGPWELESNLFGEDVLAFLMSTGLRTLSAPQCLKLLG
ALLLGSEPQAVVCAADWATYKPVMEARIERPLLRTLQIVEDFGDDAGSPVLEEIGRAAGP
RERVERLVGYLRDVLGDVLSVSADAIEPEADVMSHGLDSLMVMEVVKRCKKDLRVSVRPN
HLFERSTLVDWADLLSGELGGAGDDDSAAAEPTEAVMADPANIAEDVSLAPDIVPEGPLR
DGYQDPRQVLLTGATGFLGAYLLDELLATTEATVHCLVRCQDPADGLARIRANYEKYLPW
RTESEDRISVLPGDLEKPLLGLPDEQFDTLAHELDAIYHNGAWVNFTYTYEQLRAANLAG
CEEILRLACRGPLTPVNHMSTYGIWGLPADGRTVIRETDDITGAGKLVTGYVQTKWAAER
LMEIGRSRGIPVDIHRPGRVLGDSRTGAALTTHFTTRVIKGCIQLGIAPALDLEIEMTPV
DYVVRSLVRISREPHAFGETYHLVNGRKMTFERLIRAITGYGWKVEVVPVDTWWGTRLQD
SYAEQDNELHPVMEVVEEFVVGGEEAIDYDDSNAERVLKGTGISCPPLDEALLGTYFDWM
VRSGYLPEPRG
selected fasta
>polyketide synthase [polyketide synthase]
ATGACGACGACGCAGAGCGGCCCGGCGCAGGAGTACCGGACCCGGCTCGTCGAGGCCCTG
CGCACCATCGAGCGGTTGCAGGACCGACTGAAGAAGGCCAACGACCGCCCGCAACGCCTC
AGTGAGCCCATCGCCATCGTCGGCCTCGGCTGCCGGCTGCCCGGGGGCGCGGACAGCCCC
GAGGCGTTCTGGCGGGTCCTGCGGGACGGGGTGGACACCACCTCCGAGTTCCCCGCGGAA
CGCGGCGACGCCTCGGCGCTGTACGACCCGGACCCCGACGCGCCCGGCAAGGCCTATGTG
ATCAGGGGCGCCTTCCTGGGCCGGGTGGACACCTTCGAGCCCAGCGTCTTCGGCATCTCG
CCGCGCGAGGCGCTGGGCATGGACCCGCAGCAGCGCATCACGCTGGAGGTCGCCTGGGAG
GCGCTGGAGCGCGCCGGCTACGCGCCGGACAGCCTCTCCGGCAGCGCCACCGGCGTCTAC
CTGGGGCTGAGCACCACCGACTACGTACGGATGCGGCAGAGCGAGGGCGACATCCGTGAC
GTGGACGCCTACCAGCTCGTCGGGGAACCCAGCTTCGCGGCCGGCCGGATCTCCTACACC
CTGGGCCTGCAGGGCCCGAGCAAGGTCATGGACACCACCTGTTCGTCCTCGCTGGTCGCC
CTGCACGAGGCGTGCCAGGGCCTGCGCCTCGGCGAGTGCGACATGGCGCTGGCCGGTGGT
GTCAACCTGATGCTGTCGCCCTACGGCTTCGTCATGATGAGCAAGTTCGCCGGGCTCTCC
CCGGAGGGCCGCTGCAAGACGTTCGACGCCAGCGCCGACGGGTACGCCCGCGGCGAGGGC
TGCGGCGTGGTCGTGCTCAAGCGGTACTCCGACGCGCTGCGCGACGGGGACAACGTCATC
GCCCTGGTCCGCGGCACCGCGGTCAACCACGACGGCCGCAGCAGCGGACTCACCGTGCCC
AACCCGGCCGCCCAGCAGGACGTGATCCGGGCGGCACTGGCCCAGGCCGGCATCGCCCCC
GGCGACGTGGACTACGTGGAGGCGCACGGCACCGGGACCGCGCTCGGCGACCCCATCGAA
CTGCGGGCGCTGGAAGCGGTCATCGGCCGCAACCGGCCGGCGGGCTCCCCGTTGCTCGTC
GGCTCGGTCAAGACCAACATCGGGCACCTGGAGTCCGCCGCGGGCGTCGCCGGGCTGCTC
AAACTGGTGCTGGCCCTGCAACACGGCCAGATCCCGCCGCACCTGCACTTCACCGACCCC
AACCCCAACGTGGACTGGAGCCGGCTGCACATCGAGGTCACCGCGCAGGGCCGGCCCTGG
CCGACGAGCGACCGCCCGGCCATCGGTGCCATCAGCAGCTTCGGCGCCAGCGGGACCAAC
GCCCACGCCGTGGTCAGCGCCCCGCCGGCACCCGCCGGGAACGGACAGAACGGGGTCACC
CGCGACGTCCTGGTGCTCTCCGCGAACACCGAGGAGTCGCTCACCGAACTCGCCCGGAAG
TACGCCCTGCACCTGCGCCGCGAACCCGACCTGACGCTCGGCGACGCCTGCCACACCACC
CAGGTGGGCCGGTCCCGGCAGAGCTACGGCCTGGCCGTCGCCGGCGACTCCCTGGACTCG
CTGGCCGACGCCCTCGACGCACACCTGCGCGGCGGCCGGGACCCCCGGGTGGACACCGCC
AGGTTGCCCGTGCACAAGTACCGCAAGACCGGCTGGCTCTTCACCGGGCAGGGCGCCCAG
TACGCGCAGATGGCCCGGGGCCTCGCCGACGAGCCCGCGTTCCGGGAGGCGTTCGACGCC
TGCGCGGAGCTGTTCGACCCGCTGCTCGGCCGGTCGCTGGCCTCGGTGGTGTGGCCGGAG
CCCGGCACCGAGTCGCCCATCGACGACACCCGCTACACCCAGCCGGCGCTCTTCGCCGTC
GAGTACGCCCTGGCCCGGATGTGGCTCGGCTGGGGCCTGAAGCCCAGCGCCCTGCTCGGA
CACAGCATCGGGGAGCTCGCCGCCGCCTGCATCGCCGGGGTGTTCTCCCTGCCGGACGCC
GTCCGGCTGGTCGCCGCCCGCGCCTCGCTGATGGCCGACCTCCCCGCCGGCGGCGCCATG
GCCGCGGTCCACTGCGACGAGGCCACCGCCCGCAGGGCCATCGCCGACCACCCCGACACC
CTGTCCCTGGCCGCGGTCAACGGGCCGCACACCGTCACCGTCTCCGGTGTCGCCGCCGAC
CTGGACGCGGTCCTCGCCACCCTCAAGGAACAGGGGGTGCGCAGCCAGCGGCTCACCGTC
TCGCACGCCTTCCACTCCCCGCTGCTGCGGCCCATGCTCGACGAGTTCCGCAGGGTCGCC
GGGACCATCACCTACGCGGCGCCCACCATCCCGCTGTACTCCAACGTCACCGGGCAGTTG
TGGACGGCCGCCGAGGTCGGCCCGGAGTACTGGGTGCGGCACGCCGCCGGCGCGGTCCGC
TTCCACGACGGGATCACCGGACTCCACGCCTCAGGGGTGCGCACCTTCCTCGAGGTCGGA
CCCGCCCCCGTGCTCGTGGGGATGGGCAGCAGGGCCGTGGAGGACCCGGACTGCACCTGG
ATCGCCTCGCTGCGCCGGCCCACCCGCAAGGGCGCCTCGCTGCACGACCAGGACAGCGTC
CGGCAGGCGCTGGGACTGCTCTACCTGCGCGGCGGCACCGTGGACTGGGCCGCGGTGCAC
GCCGGCCAGAACCCGCGCCGGGTCCCGCTGCCCACCGCGGTGTGGCGCGGCGACTCCTAC
TGGTTCGCCGAGCGCCGCAAGGACGCCGAGGCCGCGCCGGCGCCCCGGGCCGGCACCGTG
GTGCCGTCGATCGGGCTCCGCCTGCACAGCGCCGTGCCCACCTACGAGGTGAACCTCGAC
GACGCCCGCTGGGAGCCGTACGCCCGGCAGGCCACCGACGGCCGCAGCTACCTGCCGGTG
GGCGCGCTCGCCGCGGTGATGCAGGACGCGGTGGCGGACGCCTTCGGTGGGCGCTGGGAC
TGCCTCGAGGAGCTCATCATCGACCAGCGCATCCCCAGGGACGGGGACGGCCGGATCGTG
CAGATCACCCTGCGCTCGACCAGCGACGGCCACGCCACCTTCGAGTGGCACAGCATCACC
CCGGACGAGGAGGCCGCGGGCGCCCCCTGGAAGCTGCACGGCCACGGCCTGCTGCGCCGC
CGCGCCTCGGGCCGCCGCCTGGCGCCCGAGCTCCAGGTCCACCGCTACGGGGACGCCGTC
AGCTACGAACCCGCCGCGCTGTCCTCGGCGCTGGCCGGAGCGGTCACCGGGGCCTCGCGG
GGCGGCGGTGGCGTCCTGGTCGCCCTCGCCCCGGAGCGCGCCGAGGGCGGGCTGAGCTGG
GTGGAGATCGTGGACGCCGCGGTCGCCGCGCTGTCCTGGGACGCCGGGGTGGACACCCAG
GAGGTCGGCTTCACCCGCCGGGTCAGCGACCTGATCTGCGAGGACCCGCGGCGCGTCGCC
TACGTGCGGGCCACCGCCCACCGGACCACGGGCACCTCCGAGCACCTGCACGAGGTGCTG
GGCGGCGCGGAGTTCTTCGCCGAGGACGGCGCCCACATCGGCAGCATCGGCGAGTTGCTG
GTGGTTGGCAACAAGGCCGCGCCGGCGCAGAGCGCCCCGTGGCGGCACCCGGACGAACTG
CTCCAGCGGGTCGAGTGGCAGGTCGCCCCGGCCCCGCCGTCCCCCGGACGCCTGGACGAC
GAGAACTGGCTGCTGGTTCCGGACCGTGACGGCGTCGCCGACCGGCTCGCCGAGGAGCTG
CGCCGGCGCGGGGCCCGCTGCCTGGTCGCCGCACCCGACGTGGCGGGCACGGACCGGGCG
GCGGTGACCGAGCTGCTCGCGCGCTGGCGGGACCAGTCCGTGCCGACCGACACCGCGGAC
CGGATCGTCCTGCTGACCGGCCTCGACGCGCCCGAACCCGAGGCCGCCGACGCCGAGGCG
CTGGTGGAGTACCGGGACCGCACCGAACTGACCGTGGTGTCCCTGGTGCAGGGGCTGCTG
GCCCGCGAGGACTGCGCCAAGGCCACGGTCTCCTTCGTCACCCGGGGCACCATGCCGGCC
CAACGTGCCCGGGGCGACGTCAGCTCCCCGTTCGGCAACACCCTGTGGGGGCTCGGCCGG
GTGGTCGCGCTGGAGCACCCCGAACACTGGGGCGGAGCGGTGGACCTGGACCCGGCGGGT
CCGCTCACCGACGACGTCGCCAGACTCGCGGACGCCCTGCTCGACGTGCGGGCCGAGGAC
CAGCAGGCGCTGCGCGGCGACACCCGCTACGTGGCGAGGCTGGTGCCGCACAGCGTCACC
CAGGAGGAGCTGCGGAGCACCCCGCCGGTCAGGTCGTCGGCGTCGTACCTGATCACCGGC
GCGTTCGGTGGGATCGGCCGGGCCCTGTCCCGCTGGCTGGCGATCAACGGCGCGGGGAAG
CTGGTCCTGGTGGGCCGGACCCCGCTGCCGCCGCGGACCGACTGGGACATGCCGGGGCTC
TCCCAGGCGGTCCGGGAGCGGATCGACCTGGTCCGGGAGTTGGAGGCCACCGGTGCCCTG
GTCGAGGTGGCCGCCGCGGACGTCTGCGACCCCGCCCAGTTGCTGCCGGTCATGGAGGAC
CTGGCGGTGGACTCCCGCCCGTTGGCCGGCGTGGTGCACGCGGCGGGTCTGTCCGTCCCA
CAGTTCCTGCGCGACATCACCGTGGAGACGCCCGACGACTACGACGCGGTCTGGCGTCCC
AAGGTCGTCGGTGGCTGGCTGCTGCACCAACTGACCGAGGGCGCGGAGCTCGACTTCTTC
CTCGGGTTCTCGTCGATCGCCGCCACCTGGGGCTCCCAGCACCTGTCCAGCTACTCCGCG
TCCAACGCGTTCCTCGACGGGCTCGCGGAGTACCGGCGGGGGCTCGGACAGGCCGCGCTC
ACCGTGAGCTGGGGCCCCTGGGAGCTGGAGTCCAACCTGTTCGGCGAGGACGTGCTGGCG
TTCTTGATGTCCACCGGGCTACGGACCCTGTCCGCGCCGCAGTGCCTGAAGCTGCTCGGC
GCGCTGCTGCTCGGCAGCGAGCCGCAGGCGGTGGTCTGCGCCGCGGACTGGGCCACCTAC
AAGCCGGTGATGGAAGCCAGGATCGAACGTCCGCTGCTGCGCACGCTCCAGATCGTCGAG
GACTTCGGGGACGACGCCGGGTCGCCGGTGTTGGAGGAGATCGGCCGGGCGGCCGGTCCG
CGTGAACGCGTCGAACGACTCGTCGGCTACCTGCGGGACGTCCTGGGTGACGTGCTGTCG
GTCAGTGCGGACGCCATCGAGCCGGAGGCCGACGTGATGTCCCACGGCCTGGACTCGCTG
ATGGTGATGGAGGTCGTCAAGCGCTGCAAGAAGGACCTGCGGGTCAGCGTGCGCCCCAAC
CACCTGTTCGAGCGGTCCACCCTGGTGGACTGGGCTGACCTGCTCTCCGGTGAGCTCGGC
GGGGCGGGCGACGACGACTCGGCCGCGGCGGAGCCCACGGAGGCGGTGATGGCCGACCCG
GCGAACATCGCCGAGGACGTCTCCCTCGCCCCGGACATCGTCCCGGAGGGCCCCCTACGG
GACGGTTACCAGGACCCCCGCCAGGTGCTGCTCACCGGCGCCACCGGCTTCCTCGGCGCC
TACCTGCTGGACGAGCTGCTGGCCACCACGGAGGCGACCGTGCACTGCCTGGTGCGGTGT
CAGGACCCGGCCGACGGGCTCGCCCGCATCCGGGCCAACTACGAGAAGTACCTGCCCTGG
CGCACGGAGTCCGAGGACCGGATCTCGGTGCTGCCGGGAGACCTGGAGAAGCCCCTGCTC
GGCCTCCCGGACGAGCAGTTCGACACCCTCGCCCACGAGCTGGACGCGATCTACCACAAC
GGTGCCTGGGTGAACTTCACGTACACCTACGAGCAACTGCGGGCCGCCAACCTGGCCGGG
TGTGAGGAGATCCTGCGCCTGGCGTGCCGGGGGCCGCTCACCCCGGTCAACCACATGTCC
ACCTACGGCATCTGGGGTCTGCCGGCGGACGGCCGGACGGTGATCAGGGAGACCGACGAC
ATCACCGGCGCCGGGAAGCTGGTCACCGGCTACGTGCAGACCAAGTGGGCCGCCGAGCGG
CTCATGGAGATCGGCCGGTCCCGGGGCATCCCGGTGGACATCCACCGACCGGGCCGGGTG
CTGGGCGACTCCCGCACCGGGGCCGCGCTGACCACCCACTTCACCACCCGGGTGATCAAG
GGGTGTATCCAGCTCGGTATCGCGCCGGCGCTCGACCTGGAGATCGAAATGACGCCGGTG
GACTACGTCGTCCGGTCGTTGGTGCGCATTTCCCGGGAGCCGCACGCGTTCGGGGAGACC
TACCACCTCGTCAACGGGCGCAAGATGACCTTCGAGCGGCTGATCCGGGCGATCACCGGG
TACGGCTGGAAGGTCGAGGTCGTACCGGTGGACACCTGGTGGGGCACCCGGCTGCAGGAC
TCCTACGCCGAGCAGGACAACGAACTGCACCCCGTGATGGAGGTCGTCGAGGAGTTCGTC
GTCGGTGGCGAGGAGGCCATCGACTACGACGACAGCAACGCGGAGCGCGTGCTCAAGGGA
ACGGGAATCAGTTGCCCGCCGCTGGACGAGGCGCTACTCGGCACGTATTTCGACTGGATG
GTGCGCAGCGGCTATCTGCCCGAGCCGCGCGGCTGA
[3] KS42..417
[3] AT572..870
[3] malonyl-CoA762..766
[3] KR1454..1650
[3] ACP1743..1816
[3] R1868..2226
[3] KS124..1251
[3] AT1714..2610
[3] malonyl-CoA2284..2298
[3] KR4360..4950
[3] ACP5227..5448
[3] R5602..6678

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [570-691]  3.90000000000001e-78 G3DSA:3.40.366.10 [761-867]  3.90000000000001e-78 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR009081 Acyl carrier protein-like (Domain)
 [1740-1819]  5e-12 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1750-1815]  4.5e-09 PF00550
PF00550   PP-binding
 [1743-1816]  PS50075
PS50075   ACP_DOMAIN
 [1740-1835]  1.29999924468179e-16 SSF47336
SSF47336   ACP_like
IPR010080 Thioester reductase (Domain)
 [1868-2225]  1e-91 TIGR01746
TIGR01746   Thioester-redct
IPR013120 Male sterility, NAD-binding (Domain)
 [1871-2106]  2.4e-62 PF07993
PF07993   NAD_binding_4
IPR013968 Polyketide synthase, KR (Domain)
 [1454-1648]  1.99999999999999e-53 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [42-292]  2.30000000000004e-94 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [301-417]  7.00000000000005e-47 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [572-870]  1.29999999999998e-62 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [568-878]  5.50001754266469e-71 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [696-761]  4.00000300869883e-16 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [41-302]  6.90000000000007e-91 G3DSA:3.40.47.10 [304-469]  2.59999999999998e-64 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [34-416]  3.39999972437719e-105 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1455-1649]  9.9e-33 G3DSA:3.40.50.720 [1868-2139]  1.80000000000002e-41 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [573-868]  4.60000044330866e-119 SM00827
SM00827   PKS_AT
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [44-470]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1454-1650]  1.90000694315261e-42 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit