close all open/close all

CDS information : Pyrlo_00250


close this sectionLocation

Organism
StrainATCC 31673 (=NBRC 14294)
Entry namePyrrolomycin
Contig
Start / Stop / Direction44,094 / 37,591 / - [in whole cluster]
44,094 / 37,591 / - [in contig]
Locationcomplement(37591..44094) [in whole cluster]
complement(37591..44094) [in contig]
TypeCDS
Length6,504 bp (2,167 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase
Gene
Gene (GenBank)pyr25
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17158935] Cloning and characterization of the pyrrolomycin biosynthetic gene clusters from Actinosporangium vitaminophilum ATCC 31673 and Streptomyces sp. strain UC 11065. (Antimicrob Agents Chemother. , 2007)

close this sectionPKS/NRPS Module

1 malonyl-CoA
not conserved HAFHS(H->Y)
2
KS28..402
AT562..879
ACP1008..1078
KS1149..1523
AT1719..1810
KR
ACP2018..2086

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase]
MPQPTTHRKRASLPTSTSASIPAPRPDDIAVVGVGCRFPGGVRGLDSLWNVLLNGVDVVD
KVPPDRWDESFFHDDPRNPGTTYCREGGFLTDIDRFDADYFGISPREAREMDPQQRLLLE
VTAEAMDDSGLPRQRWEGTRTSVHMGILGSDYLLVHTKAAGTRTIDPYFASGKEFSFAAG
RISYVFGLHGPAMTVNTACSSSLVAVHLACQSLRNHEVDTALAGGVNAIVAPELTVFMGK
VQALSPTGRCKPFDAAADGIVRGEGCGVVVLKRYADAVRSHDQIYGVIRGSAVNQDGRSA
GLTVPNAVAQAALLRQALDSAGLDPRVPSYVEAHGTGTPLGDPLEISALAEVLGRERPAG
RPLLVGSHKANFGHMDSAAGIAGFLKSLLVLRHRTVPPQIHHHQPSPLVDWASSGIAVPT
EATELPTRRGHAVVGVSAFGLSGTNAHVLVSTPPAGRRTTHRAPSGPRTLLLSASTEEGL
RELAADYRALLDGPVYSGTRPVDIDQALAAAALRRTHHRHRLAVVGEDTAALSAALTDFQ
EGRRRPSVFTAEADDRRPAPVVYVFSGQGSQWPGMARDLYREEPVARRALDECEALIREH
AGWSLLDALADPDPDRLKATEVAQPAVFAVQVALARLWTSWGVKPDAVIGHSMGEVAAAC
VAGALSLPDAVRLIVARGRLMQRATGTGRMVNVEASAEDVRATLDERHPEVCVATVNGPR
SVVVAGPGEAVDKAVAELRAGGASTIALPVDYAFHSPLMRPYGDELESLLGSLRPAEPGV
RMVSTVAPDEPLPALDAQYWGRNLREPVLFWPAVDQVLAEGDADFVEIGAHPVLGRPLQS
AITERGRGGAVVGSLTRDKAAHTTLAHARARLHTAGVAVDWAALLRGPVRPAALPPHRWA
DERHWLSGVHRGQQSSGGFSAEGLSAQVRLFDAAGTLVGEIDAGAVATTATPRGTGANGT
PVNGAAPNGTGPLSATPTVAPQAAAPAGPAAAPDQQAAVTAPWDREQLAAAVQGALATVL
GHAPGKRLPVTRGFFELGIDSISVAELARQVEEAVGVPLDGADVLSHASVEALTDYLVTL
DPPPRNAPGRRQAPDQPAGDAPAPEAGPQVTPRQDSGGVSERPAADVRTVEPAAPAAPAP
ADQPPAGPEPIAIVGIGCRLPGGADGPQAFWRLLSDRTDTTGPVPADRWNAAELLARGKV
TPGTVATARGAFLDGVDGFDHGFFRVSPREARSMDPQQRLFLEVAWESLEDAGIRTELLR
GGRTGVFVGLNTTDYQQLVTRDHNDVDLYYGTGNSFCGTAGRLSYFLGVRGPSIAVDTAC
SSSLTAIHLACQSLRAGESDLAVAGGANVMSTPTVFLAMSAAGALAPDGRCKTFDDSADG
YGRGEGAGALVLKTLSRAVRDGDRVYAVIRGSAVNQDGASGGLTVPSGEAQEEVIRAALE
QAGVPAEHVDYVEAHGTGTRLGDAIELRALAGALGSGRAPDRPLLVGSVKTNVGHLEAAA
GVTGLIKTVLALNHQEIPAHLHVKTPTRQVAWDRLPVRVVTDATAWPRGDRPRLAGISAF
GFTGTNAHVVVEEPPAPVGRPAPQPGTGRPLVLTVTAVSAVALRATAGRWGERVAAARDD
ELADLCWASGARRTHHEHRVAVVATTRRELADALAAVARSDTADGVVLGTGRPGEYRRLG
FLYGDTVPDLPWAELLGAASPGSGDGGTARTLLGGSDAAAAFRAEVVDVDAALRDALGFS
PVRAWETGTLPEPGSTQHEALVLAGQLTGTALWSRLGMTPDTVAGHGVGEYAAAVAAVEL
TATEAVHRFAAGRGVGEPGGPGVLTRHAASAGWPAIGGLLAQDGVEVLLALGVGEPEAER
VSAAFAGNGSEVRVLRLRGRGLDPLRTAAELQVHGCRVDWDGLLPQAHRMVTLPTYPWQR
RSHWITPLAPAADPVTAPATTAPTDGGPLPSVNGAAPEATAPVPAPPVAAPPVPAGPPVS
AQGAPGAADRPEDAAGRPVTPLVAELTALPAEARAERLLTTLLDLVAEVLGGADDVAPEQ
GFFELGVDSVLGAELKERAEDQLGRELPGTIMFECPNALSFAEFILDDLFGGAEPETGPP
AAPGNAAPRPDGAGAAGTAASAGDGAVSGAEDVAEGDDGLDDLSDDALMGRLLSALSSSE
ALLTEGD
selected fasta
>polyketide synthase [polyketide synthase]
ATGCCTCAGCCGACCACCCACCGCAAGCGCGCTTCCCTCCCCACGTCCACGTCCGCGAGC
ATCCCCGCCCCGCGTCCCGACGACATCGCCGTGGTCGGTGTCGGCTGCCGGTTCCCCGGC
GGGGTGCGGGGCCTCGACTCGCTGTGGAACGTTCTGCTCAACGGTGTGGACGTGGTGGAC
AAGGTTCCTCCCGACCGCTGGGACGAGAGTTTCTTCCACGACGATCCGAGGAACCCGGGC
ACCACGTACTGCCGCGAGGGCGGATTCCTCACCGACATCGACCGTTTCGACGCCGACTAC
TTCGGCATCTCCCCCCGCGAGGCCAGGGAGATGGACCCCCAGCAACGCCTGCTGCTGGAG
GTCACCGCCGAGGCCATGGACGACTCCGGGCTGCCCAGGCAACGGTGGGAGGGCACCCGG
ACCAGCGTGCACATGGGCATCCTCGGCTCCGACTACCTGCTGGTGCACACCAAGGCGGCG
GGCACCCGGACGATCGATCCCTACTTCGCCAGCGGCAAGGAGTTCAGCTTCGCCGCCGGC
CGCATCTCCTACGTCTTCGGTCTGCACGGCCCGGCCATGACGGTCAACACCGCGTGCTCG
TCCTCGCTGGTCGCGGTCCACCTGGCCTGCCAGAGCCTGCGCAACCACGAGGTGGACACC
GCGCTCGCCGGCGGCGTGAACGCCATCGTCGCCCCCGAACTCACCGTGTTCATGGGCAAG
GTGCAGGCGCTGTCCCCCACCGGGCGGTGCAAGCCCTTCGACGCCGCCGCCGACGGCATC
GTCCGCGGCGAGGGCTGCGGCGTGGTGGTGCTCAAACGGTACGCGGACGCGGTGCGCTCC
CACGACCAGATCTACGGGGTGATCCGGGGCAGCGCGGTGAACCAGGACGGGCGCAGCGCC
GGACTCACCGTGCCCAACGCGGTGGCCCAGGCCGCCCTGCTCCGCCAGGCCCTGGACTCC
GCGGGCCTCGACCCCAGGGTGCCCTCGTACGTGGAGGCGCACGGCACCGGCACCCCGCTC
GGCGACCCGTTGGAGATCTCCGCGCTCGCCGAGGTGCTGGGCCGGGAGCGTCCCGCCGGC
CGCCCGCTGCTGGTCGGCTCGCACAAGGCCAACTTCGGACACATGGACTCCGCGGCGGGG
ATCGCCGGGTTCCTCAAGTCCCTGCTGGTGCTGCGGCACCGCACGGTCCCCCCGCAGATC
CACCACCACCAGCCGTCCCCGCTGGTGGACTGGGCGTCCTCCGGCATAGCCGTGCCCACC
GAGGCCACGGAACTTCCCACCCGGCGCGGCCACGCGGTCGTCGGCGTCAGCGCGTTCGGC
CTGTCCGGCACCAACGCCCACGTGCTGGTCTCCACCCCTCCGGCCGGCCGCAGGACCACC
CACAGGGCCCCGTCGGGGCCGCGCACCCTACTGCTCTCCGCCTCCACCGAGGAGGGCCTG
CGGGAACTCGCCGCCGACTACCGCGCGCTGCTCGACGGCCCCGTGTACAGCGGCACCCGC
CCCGTCGACATCGACCAGGCCCTGGCCGCCGCGGCCCTGCGCCGCACCCACCACCGGCAC
CGGCTGGCCGTGGTGGGCGAGGACACCGCCGCCCTGTCCGCCGCCCTCACCGACTTCCAG
GAGGGCCGCCGCCGCCCCTCGGTGTTCACCGCGGAGGCCGACGACAGGCGCCCCGCACCG
GTGGTCTACGTGTTCTCCGGACAGGGCTCCCAGTGGCCCGGGATGGCCCGTGACCTGTAC
CGGGAGGAACCGGTCGCCCGCAGGGCGCTCGACGAGTGCGAGGCGCTGATCCGTGAACAC
GCCGGGTGGTCGCTGCTGGACGCCCTCGCCGACCCGGACCCCGATCGGCTGAAGGCCACC
GAGGTGGCCCAGCCCGCGGTGTTCGCCGTGCAGGTCGCCCTGGCCCGCCTCTGGACCTCC
TGGGGAGTCAAGCCGGACGCGGTGATCGGTCACAGCATGGGCGAGGTGGCCGCCGCCTGC
GTGGCCGGCGCCCTCTCCCTCCCGGACGCCGTCCGACTGATCGTCGCCCGGGGCCGGTTG
ATGCAGCGGGCCACCGGCACCGGACGCATGGTCAACGTCGAGGCGAGCGCCGAGGACGTG
CGCGCGACCCTGGACGAACGCCACCCCGAGGTCTGCGTCGCCACCGTCAACGGCCCGCGC
TCGGTCGTGGTCGCCGGCCCCGGCGAGGCGGTGGACAAGGCGGTGGCCGAGCTCAGGGCC
GGTGGCGCCAGCACCATCGCGCTCCCCGTGGACTACGCGTTCCACAGCCCGCTGATGCGC
CCCTACGGGGACGAACTGGAGAGCCTGCTCGGCTCGCTGCGCCCGGCGGAACCCGGGGTG
CGGATGGTCTCCACCGTCGCGCCCGACGAGCCCCTGCCCGCCCTCGACGCCCAGTACTGG
GGCCGCAACCTGCGGGAACCGGTGTTGTTCTGGCCCGCCGTGGACCAGGTGCTCGCCGAA
GGCGACGCGGACTTCGTGGAGATCGGTGCCCACCCGGTGCTGGGCCGCCCGCTGCAGTCC
GCGATCACCGAACGCGGGCGCGGCGGGGCGGTGGTGGGCTCCCTGACCCGGGACAAGGCG
GCGCACACCACCCTGGCCCACGCCCGTGCCCGGCTGCACACCGCCGGGGTGGCGGTGGAC
TGGGCGGCGCTGCTGCGCGGGCCGGTGAGGCCCGCCGCGCTGCCTCCGCACCGCTGGGCC
GACGAACGGCACTGGCTGTCCGGGGTCCACCGGGGACAGCAGTCCTCCGGCGGTTTCTCC
GCGGAGGGCCTCAGCGCCCAGGTCCGGCTCTTCGACGCCGCGGGCACGTTGGTCGGGGAG
ATCGACGCGGGCGCCGTGGCCACCACGGCGACGCCGCGCGGCACCGGGGCCAACGGCACA
CCCGTCAACGGGGCCGCGCCGAACGGCACCGGTCCCCTCAGCGCCACCCCGACCGTCGCG
CCCCAGGCCGCGGCACCCGCCGGGCCCGCCGCCGCGCCCGACCAGCAGGCGGCGGTGACC
GCGCCCTGGGACCGCGAACAGCTCGCCGCCGCGGTGCAGGGCGCCCTGGCCACGGTGCTC
GGCCACGCCCCGGGCAAGCGGCTCCCGGTCACCCGGGGCTTCTTCGAGTTGGGCATCGAC
TCCATATCGGTCGCCGAACTCGCCCGCCAGGTCGAGGAGGCCGTGGGCGTGCCGCTCGAC
GGTGCCGACGTGCTCTCGCACGCCAGCGTCGAGGCGCTGACCGACTACCTCGTCACCCTG
GACCCACCGCCCCGGAACGCGCCCGGCCGGCGCCAGGCGCCGGACCAGCCGGCCGGCGAC
GCCCCCGCCCCGGAGGCCGGCCCGCAGGTGACACCCCGGCAGGACTCCGGCGGGGTGTCC
GAGCGGCCGGCGGCCGACGTGCGGACGGTCGAGCCCGCGGCACCCGCCGCGCCCGCCCCC
GCCGACCAGCCGCCGGCGGGGCCCGAGCCGATCGCGATCGTCGGCATCGGCTGCCGACTC
CCCGGGGGAGCTGACGGCCCGCAGGCGTTCTGGCGGCTGCTCAGCGACCGCACCGACACC
ACGGGTCCCGTTCCGGCCGACCGGTGGAACGCCGCCGAACTGCTGGCCCGCGGAAAGGTC
ACCCCCGGCACGGTGGCCACCGCGCGGGGGGCGTTCCTCGACGGGGTGGACGGCTTCGAC
CACGGCTTCTTCCGCGTCTCGCCCCGTGAGGCGCGCAGCATGGACCCGCAGCAGCGGCTG
TTCCTCGAGGTCGCCTGGGAGTCCCTGGAGGACGCAGGCATCCGCACGGAACTGCTGCGC
GGTGGGCGCACCGGGGTGTTCGTCGGCCTCAACACCACCGACTACCAGCAGTTGGTGACC
CGGGACCACAACGACGTGGACCTGTACTACGGCACCGGGAACTCGTTCTGCGGCACCGCG
GGCCGGCTCTCGTACTTCCTCGGCGTGCGCGGGCCGAGCATCGCCGTGGACACCGCCTGC
TCGTCCTCGTTGACCGCGATCCACCTCGCCTGCCAGTCGCTGCGCGCCGGGGAGAGCGAC
CTGGCGGTCGCCGGGGGCGCCAACGTGATGTCCACCCCGACGGTGTTCCTGGCGATGTCG
GCGGCCGGGGCGCTGGCACCGGACGGACGGTGCAAGACCTTCGACGACTCGGCCGACGGG
TACGGACGCGGCGAGGGCGCCGGCGCGCTGGTCCTGAAGACCCTCTCCCGCGCCGTCCGC
GACGGTGACCGGGTGTACGCCGTCATCCGCGGCAGCGCGGTCAACCAGGACGGGGCCAGC
GGCGGCCTGACCGTTCCCAGCGGCGAGGCCCAGGAGGAGGTCATCCGGGCGGCGCTCGAG
CAGGCCGGCGTCCCCGCGGAGCACGTGGACTACGTGGAGGCGCACGGCACCGGCACCAGG
CTCGGCGACGCCATAGAACTGCGGGCGCTCGCCGGGGCGCTGGGGTCGGGGCGTGCCCCG
GACCGGCCGCTGCTCGTGGGGTCGGTCAAGACCAACGTCGGGCACCTGGAGGCGGCGGCC
GGCGTCACCGGCCTGATCAAGACCGTGCTGGCGCTCAACCACCAGGAGATACCCGCGCAC
CTGCACGTGAAGACCCCGACCCGCCAGGTCGCCTGGGACCGCCTGCCGGTGCGCGTGGTC
ACCGACGCCACGGCCTGGCCCCGCGGCGACCGGCCGCGGCTGGCCGGGATCAGCGCCTTC
GGGTTCACCGGGACCAACGCCCACGTGGTGGTGGAGGAGCCGCCGGCCCCGGTCGGCCGG
CCGGCGCCCCAACCCGGGACGGGGCGGCCCCTGGTGCTGACGGTGACGGCGGTGAGCGCG
GTGGCGTTGCGGGCCACCGCGGGCCGGTGGGGCGAACGGGTCGCCGCCGCCCGTGACGAC
GAGCTGGCCGACCTGTGCTGGGCCTCGGGGGCGCGGCGCACCCACCACGAACACCGGGTG
GCGGTCGTCGCCACGACCCGCCGGGAGCTGGCGGACGCCCTGGCCGCGGTGGCCAGGTCC
GACACCGCGGACGGGGTGGTCCTGGGCACCGGACGCCCCGGGGAGTACCGCAGGCTCGGC
TTCCTGTACGGCGACACCGTGCCCGACCTGCCGTGGGCCGAGCTGCTCGGGGCGGCCTCG
CCGGGGAGCGGGGACGGCGGCACCGCGCGGACCCTGCTCGGCGGTTCCGACGCCGCCGCG
GCGTTCCGCGCCGAGGTGGTGGACGTGGACGCGGCACTGCGCGACGCGCTGGGCTTCTCC
CCGGTGCGGGCCTGGGAGACCGGCACGCTGCCCGAGCCCGGTTCGACGCAGCACGAGGCG
CTGGTCCTCGCCGGGCAGTTGACGGGGACGGCGCTGTGGTCCCGGCTGGGGATGACCCCC
GACACGGTGGCCGGCCACGGGGTGGGGGAGTACGCCGCGGCGGTGGCCGCCGTCGAGCTG
ACCGCCACCGAGGCGGTGCACCGGTTCGCCGCCGGTCGAGGGGTCGGTGAGCCCGGCGGG
CCCGGCGTGCTGACCCGTCACGCGGCGTCGGCCGGCTGGCCGGCGATCGGTGGCCTGCTG
GCCCAGGACGGCGTGGAGGTGCTCCTCGCCCTCGGGGTCGGTGAGCCGGAGGCCGAGCGG
GTGTCCGCCGCGTTCGCCGGCAACGGTTCCGAGGTGCGGGTGCTGCGGCTGCGCGGGCGG
GGCCTCGACCCGCTGCGCACCGCCGCCGAACTCCAGGTGCACGGCTGCCGGGTGGACTGG
GACGGGCTGCTGCCGCAGGCGCACCGGATGGTGACCCTGCCGACCTACCCGTGGCAGCGC
CGCAGCCACTGGATCACGCCCCTGGCCCCGGCGGCCGACCCCGTGACGGCTCCGGCGACC
ACCGCGCCCACGGACGGCGGCCCGCTCCCGTCGGTGAACGGGGCGGCTCCGGAGGCCACA
GCCCCGGTCCCCGCCCCGCCTGTCGCCGCCCCGCCCGTCCCCGCCGGCCCCCCGGTGTCC
GCCCAGGGCGCCCCGGGCGCCGCTGACCGGCCCGAGGACGCCGCTGGCCGCCCCGTCACC
CCGCTGGTGGCCGAGTTGACCGCGTTGCCCGCCGAGGCCCGCGCGGAGCGGCTGCTGACC
ACGCTGCTCGACCTGGTCGCCGAGGTGCTGGGGGGAGCCGACGACGTCGCCCCGGAACAG
GGCTTCTTCGAACTGGGTGTGGACTCGGTGCTCGGCGCGGAACTCAAGGAGCGGGCCGAG
GACCAGTTGGGCAGGGAACTGCCGGGAACGATCATGTTCGAGTGTCCGAACGCCCTTTCG
TTCGCTGAGTTCATCCTCGACGACCTGTTCGGCGGGGCCGAGCCGGAGACCGGGCCGCCG
GCCGCGCCGGGCAACGCCGCCCCCCGCCCCGACGGCGCCGGCGCGGCCGGCACCGCCGCC
AGCGCAGGGGACGGCGCGGTATCCGGCGCGGAGGACGTCGCCGAAGGGGACGACGGCCTC
GACGACCTCAGTGACGACGCGCTGATGGGGCGCCTGCTTTCCGCGCTCTCCAGCTCCGAA
GCCCTGCTGACCGAGGGAGACTGA
[1] KS28..402
[1] AT562..879
[1] malonyl-CoA not conserved HAFHS(H->Y)752..756
[1] ACP1008..1078
[2] KS1149..1523
[2] AT1719..1810
[2] ACP2018..2086
[1] KS82..1206
[1] AT1684..2637
[1] malonyl-CoA not conserved HAFHS(H->Y)2254..2268
[1] ACP3022..3234
[2] KS3445..4569
[2] AT5155..5430
[2] ACP6052..6258

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [552-684]  1.99999999999999e-89 G3DSA:3.40.366.10 [752-867]  1.99999999999999e-89 G3DSA:3.40.366.10 [1721-1806]  1.99999999999999e-89 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [1036-1051]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1005-1079]  9.20000000000002e-29 G3DSA:1.10.1200.10 [2010-2086]  9.20000000000002e-29 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1008-1078]  PS50075 [2018-2086]  PS50075
PS50075   ACP_DOMAIN
 [1001-1165]  7.19999557654549e-21 SSF47336 [2010-2103]  3.1999989904635e-16 SSF47336
SSF47336   ACP_like
 [1011-1077]  7.90000000000001e-11 PF00550 [2021-2085]  2.80000000000001e-12 PF00550
PF00550   PP-binding
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [28-277]  7.59999999999998e-88 PF00109 [1149-1398]  6.99999999999989e-91 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [285-402]  9.69999999999989e-39 PF02801 [1406-1523]  2.89999999999999e-44 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [562-879]  3.30000000000002e-91 PF00698 [1719-1810]  6.80000000000001e-11 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [560-862]  2.89997807423187e-71 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [686-751]  2.59999946718995e-16 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [27-288]  G3DSA:3.40.47.10 [289-454]  4.40000000000003e-118 G3DSA:3.40.47.10 [1149-1409]  G3DSA:3.40.47.10 [1410-1575]  4.40000000000003e-118 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [19-401]  2.19999900980707e-96 SSF53901 [1141-1522]  3.699978135861e-103 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [190-206]  PS00606 [1311-1327]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [564-859]  1.39999277195148e-111 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1009-1081]  2.00000075217457e-16 SM00823 [2019-2089]  9.80000272130218e-15 SM00823
SM00823   PKS_PP
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [29-455]  SM00825 [1151-1576]  SM00825
SM00825   PKS_KS
SignalP
 [1-11]  0.526 Signal
Bacteria, Gram-negative   
TMHMM No significant hit