close all open/close all

CDS information : Pyrlo_00260


close this sectionLocation

Organism
StrainATCC 31673 (=NBRC 14294)
Entry namePyrrolomycin
Contig
Start / Stop / Direction44,146 / 45,054 / + [in whole cluster]
44,146 / 45,054 / + [in contig]
Location44146..45054 [in whole cluster]
44146..45054 [in contig]
TypeCDS
Length909 bp (302 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative type II thioesterase
Product (GenBank)thioesterase
Gene
Gene (GenBank)pyr26
EC number
Keyword
  • type II thioesterase
Note
Note (GenBank)
Reference
ACC
PmId
[17158935] Cloning and characterization of the pyrrolomycin biosynthetic gene clusters from Actinosporangium vitaminophilum ATCC 31673 and Streptomyces sp. strain UC 11065. (Antimicrob Agents Chemother. , 2007)
Related Reference
ACC
Q9ZGI1
NITE
Pikro_00070
PmId
[9770448] A gene cluster for macrolide antibiotic biosynthesis in Streptomyces venezuelae: architecture of metabolic diversity. (Proc Natl Acad Sci U S A. , 1998)
[10421766] Elucidating the mechanism of chain termination switching in the picromycin/methymycin polyketide synthase. (Chem Biol. , 1999)
[10676969] Alternative modular polyketide synthase expression controls macrolactone structure. (Nature. , 2000)
[10713461] Genetic architecture of the polyketide synthases for methymycin and pikromycin series macrolides. (Gene. , 2000)
[11223265] The Streptomyces venezuelae pikAV gene contains a transcription unit essential for expression of enzymes involved in glycosylation of narbonolide and 10-deoxymethynolide. (Gene. , 2001)
[12368286] Biochemical evidence for an editing role of thioesterase II in the biosynthesis of the polyketide pikromycin. (J Biol Chem. , 2002)

close this sectionSequence

selected fasta
>putative type II thioesterase [thioesterase]
MNSYVRSLATVTQAACAALEAVGKAPRRGKEPDPEGPLTTPVSPDPGATRDDANSLTLYC
LAHAGGSAIPYTRWNRFLPAGVRVEPLELPGHGARLREPLLEQVEPIVADLLRTVGPRRG
APFALFGHSFGAVLAFELTRRLVRLGTPPAALLVAGRNGPTQPLAHRPIHNLDDEAFVAA
LIRFGGMPQALLEQPELLRIYLPVLRVDLRLAETHPRPPGPPFDVPVTAFGGRRDVLADP
EGLLTWERETTGEFELALLPGGHFFLDEPAFHSLLLSRLARLTPRATGNDPLSRGTTPAA
RR
selected fasta
>putative type II thioesterase [thioesterase]
ATGAATTCGTACGTGAGATCGCTCGCCACCGTTACTCAAGCCGCTTGCGCCGCACTAGAG
GCAGTGGGGAAGGCCCCCAGGCGGGGCAAGGAACCAGACCCGGAGGGCCCGTTGACCACA
CCTGTCTCCCCCGATCCCGGCGCGACCAGGGACGACGCCAACTCACTCACGCTGTACTGC
CTGGCCCACGCGGGCGGCAGCGCCATCCCCTACACGCGGTGGAACCGGTTCCTGCCGGCC
GGTGTCAGGGTCGAACCCCTGGAACTCCCGGGCCACGGCGCGCGGCTGCGCGAGCCGCTG
CTCGAGCAGGTGGAGCCCATCGTGGCGGACCTGTTGCGCACCGTGGGGCCGCGCCGGGGA
GCGCCGTTCGCACTCTTCGGTCACAGTTTCGGCGCGGTACTCGCGTTCGAGTTGACCCGC
CGGCTGGTCCGCCTCGGCACTCCGCCCGCCGCCCTCCTGGTCGCCGGGCGCAACGGCCCG
ACCCAGCCGCTGGCCCACCGCCCGATCCACAACCTGGACGACGAGGCGTTCGTCGCGGCG
CTCATCCGGTTCGGCGGCATGCCGCAGGCCCTGTTGGAGCAGCCGGAACTGCTGCGGATC
TACCTGCCGGTGCTGCGGGTGGACCTACGGCTCGCCGAAACCCATCCGCGCCCGCCGGGG
CCGCCGTTCGACGTGCCGGTGACGGCCTTCGGCGGCCGGCGGGACGTGCTCGCCGACCCG
GAGGGCCTGTTGACCTGGGAGCGGGAGACCACCGGGGAGTTCGAGCTCGCCCTGCTTCCC
GGCGGTCACTTCTTCCTCGACGAACCGGCGTTCCACTCCCTGCTGCTGTCCCGGCTGGCC
CGCCTGACCCCACGGGCCACCGGGAACGATCCGCTCAGCCGCGGAACGACACCGGCAGCG
CGCCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [57-268]  1.29999999999998e-38 PF00975
PF00975   Thioesterase
SignalP
 [1-17]  0.734 Signal
Bacteria, Gram-negative   
 [1-17]  0.563 Signal
Bacteria, Gram-positive   
TMHMM No significant hit