close all open/close all

CDS information : Pyrlo_00270


close this sectionLocation

Organism
StrainATCC 31673 (=NBRC 14294)
Entry namePyrrolomycin
Contig
Start / Stop / Direction45,643 / 45,020 / - [in whole cluster]
45,643 / 45,020 / - [in contig]
Locationcomplement(45020..45643) [in whole cluster]
complement(45020..45643) [in contig]
TypeCDS
Length624 bp (207 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative TetR family transcriptional regulator
Product (GenBank)TetR family regulator
Gene
Gene (GenBank)pyr27
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17158935] Cloning and characterization of the pyrrolomycin biosynthetic gene clusters from Actinosporangium vitaminophilum ATCC 31673 and Streptomyces sp. strain UC 11065. (Antimicrob Agents Chemother. , 2007)
Family/Domain
FD
IPR001647

close this sectionSequence

selected fasta
>putative TetR family transcriptional regulator [TetR family regulator]
MTRTARKRTGRRPGNTESRQLILDAARAKFATHGYEGASIRSIAQEAGVDTALIHHFFTS
KDGLFSAAVHDAVHPEQLVAAVVGKRRALRGLGERMVRAIVGLWEGEVSRNQMSSIMRSA
VSHEVAAQLLRRFFTEEVALPVARSTGKSDPEVRAALVTSQLVGLAMTRYIVQVHPIDKL
PADELVACIAPTIQRYLTGALPVSFRG
selected fasta
>putative TetR family transcriptional regulator [TetR family regulator]
CTGACGCGCACCGCGCGGAAGCGGACCGGGCGTCGTCCGGGCAACACCGAGAGCAGGCAG
CTCATCCTGGACGCGGCGCGCGCCAAGTTCGCCACCCATGGCTACGAGGGCGCCTCCATC
CGGTCCATCGCCCAGGAGGCCGGGGTGGACACCGCCCTGATCCACCACTTCTTCACGTCC
AAGGACGGCTTGTTCTCCGCCGCGGTGCACGACGCGGTCCACCCGGAGCAGCTCGTCGCC
GCGGTGGTGGGGAAGCGGCGGGCGCTGCGCGGGCTCGGGGAACGGATGGTCCGGGCCATC
GTCGGGCTCTGGGAGGGCGAGGTCAGCCGGAACCAGATGAGCAGCATCATGCGCTCGGCG
GTGTCCCACGAGGTGGCAGCGCAACTGCTCCGCCGGTTCTTCACCGAGGAGGTCGCGCTG
CCCGTCGCGCGGTCCACCGGCAAGTCCGACCCCGAGGTGCGCGCCGCGCTGGTCACCTCG
CAGTTGGTCGGCCTGGCCATGACCCGGTACATCGTGCAGGTGCACCCGATCGACAAGCTG
CCCGCCGACGAGCTGGTGGCGTGCATCGCGCCGACGATCCAGCGCTACCTCACCGGCGCG
CTGCCGGTGTCGTTCCGCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [22-67]  4.6e-14 PF00440
PF00440   TetR_N
 [22-35]  1.49999977583352e-07 PR00455 [43-66]  1.49999977583352e-07 PR00455
PR00455   HTHTETR
 [16-76]  PS50977
PS50977   HTH_TETR_2
IPR009057 Homeodomain-like (Domain)
 [6-96]  7.09999884211141e-16 SSF46689
SSF46689   Homeodomain_like
 [8-67]  1.6e-19 G3DSA:1.10.10.60
G3DSA:1.10.10.60   Homeodomain-rel
IPR011075 Tetracycline transcriptional regulator, TetR-related, C-terminal (Domain)
 [89-200]  2.90000354677981e-35 SSF48498
SSF48498   TetR_like_C
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [73-199]  3.80000000000003e-43 G3DSA:1.10.357.10
G3DSA:1.10.357.10   TetR_C
SignalP No significant hit
TMHMM No significant hit