close all open/close all

CDS information : Pyrlo_00280


close this sectionLocation

Organism
StrainATCC 31673 (=NBRC 14294)
Entry namePyrrolomycin
Contig
Start / Stop / Direction45,992 / 46,264 / + [in whole cluster]
45,992 / 46,264 / + [in contig]
Location45992..46264 [in whole cluster]
45992..46264 [in contig]
TypeCDS
Length273 bp (90 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative peptidyl carrier protein
Product (GenBank)proline carrier protein
Gene
Gene (GenBank)pyr28
EC number
Keyword
  • pyrrole ring moiety
Note
Note (GenBank)
Reference
ACC
PmId
[17158935] Cloning and characterization of the pyrrolomycin biosynthetic gene clusters from Actinosporangium vitaminophilum ATCC 31673 and Streptomyces sp. strain UC 11065. (Antimicrob Agents Chemother. , 2007)
Related Reference
ACC
Q9X3R0
NITE
Pyolu_00030
PmId
[11880032] Conversion of L-proline to pyrrolyl-2-carboxyl-S-PCP during undecylprodigiosin and pyoluteorin biosynthesis. (Chem Biol. , 2002)

close this sectionPKS/NRPS Module

0
PCP16..82

close this sectionSequence

selected fasta
>putative peptidyl carrier protein [proline carrier protein]
MTAISRDEIYTKLSAYIQEQFLDDSEISELKPDTPLLEWGVLNSMNTSILLTYIRTDLGV
TVPPTHITGRHFYSLDTITDMVYELSLQPA
selected fasta
>putative peptidyl carrier protein [proline carrier protein]
ATGACGGCCATCAGCCGCGATGAGATCTACACGAAACTCAGCGCCTACATACAGGAACAG
TTCCTGGACGACAGCGAGATCTCGGAGCTGAAGCCGGACACCCCACTGCTGGAGTGGGGC
GTGCTGAACTCCATGAACACCTCGATCCTGCTCACGTACATCAGGACCGACCTCGGGGTC
ACCGTTCCCCCGACGCACATCACCGGTCGGCACTTCTACAGCCTCGACACCATCACCGAC
ATGGTCTACGAGCTGTCTCTTCAGCCTGCGTGA
[0] PCP16..82
[0] PCP46..246

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009081 Acyl carrier protein-like (Domain)
 [5-86]  6.40000038788486e-09 SSF47336
SSF47336   ACP_like
 [6-84]  1.2e-09 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [16-82]  0.00023 PF00550
PF00550   PP-binding
SignalP No significant hit
TMHMM No significant hit