close all open/close all

CDS information : Pyrlo_00290


close this sectionLocation

Organism
StrainATCC 31673 (=NBRC 14294)
Entry namePyrrolomycin
Contig
Start / Stop / Direction46,328 / 47,671 / + [in whole cluster]
46,328 / 47,671 / + [in contig]
Location46328..47671 [in whole cluster]
46328..47671 [in contig]
TypeCDS
Length1,344 bp (447 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative FADH2-dependent L-pyrrolyl-PCP halogenase
Product (GenBank)halogenase
Gene
Gene (GenBank)pyr29
EC number
Keyword
  • dichlorination
  • pyrrole ring moiety
Note
Note (GenBank)
Reference
ACC
PmId
[17158935] Cloning and characterization of the pyrrolomycin biosynthetic gene clusters from Actinosporangium vitaminophilum ATCC 31673 and Streptomyces sp. strain UC 11065. (Antimicrob Agents Chemother. , 2007)
Related Reference
ACC
Q9X3R1
NITE
Pyolu_00040
PmId
[10094695] Characterization of the pyoluteorin biosynthetic gene cluster of Pseudomonas fluorescens Pf-5. (J Bacteriol. , 1999)
[16162666] Dichlorination of a pyrrolyl-S-carrier protein by FADH2-dependent halogenase PltA during pyoluteorin biosynthesis. (Proc Natl Acad Sci U S A. , 2005)

close this sectionSequence

selected fasta
>putative FADH2-dependent L-pyrrolyl-PCP halogenase [halogenase]
MDAEFDIGIIGGGPAGSTAASYLAKAGLKVAVFEAETFPREHVGESLVPATTPVLIETGA
MPKVEAANFPKKFGAAWTSAEDRNIDHNGFRGLTHDFRAAEILFNERDQDGVDRDYTFHV
DRGKFDQILLQHAESLGAKVFHGIRIGKVDFDGEMPVLEAKIGSKSVDIPVRMVVDASGR
QTRLGNQLKFKVPDPIFNQYAVHSWFDNFDRKALAVNKDQADYIFIHFLPVTDTWVWQIP
ITDTITSIGVVSQKKRFQEFAGDREKFFWDTVASRPELLDALKNSDQVRPFKTEGDYSYG
MSQIAGDNFVLIGDAARFVDPIFSSGVSVALNSARLACKDIIAAAEAGDFKKERFGTYER
KLRKGVSNWYEFIQIYYRLNILFTAFVQDDRYRLDVLKMLQGDVYDDEEPKALAAMREIV
KAVEDDPTHLWHPYLGSLKAPSAKPQF
selected fasta
>putative FADH2-dependent L-pyrrolyl-PCP halogenase [halogenase]
GTGGACGCAGAGTTCGACATTGGCATCATCGGCGGCGGCCCGGCCGGCTCAACGGCTGCT
TCCTATCTCGCCAAAGCTGGCCTGAAAGTCGCAGTCTTCGAAGCCGAAACGTTCCCCAGG
GAGCATGTGGGCGAATCCCTGGTCCCCGCCACCACTCCCGTCCTCATCGAGACCGGCGCC
ATGCCCAAGGTGGAGGCGGCGAACTTCCCCAAGAAGTTCGGTGCCGCCTGGACCTCGGCC
GAAGACCGGAACATCGACCACAACGGCTTCCGCGGACTCACCCACGACTTCCGCGCCGCT
GAGATCCTGTTCAACGAGCGCGACCAGGACGGTGTGGACCGCGACTACACCTTCCACGTG
GACCGGGGCAAGTTCGACCAGATCCTCCTCCAGCACGCGGAGAGCCTCGGGGCCAAGGTG
TTCCACGGCATCCGCATCGGCAAGGTGGACTTCGACGGCGAGATGCCGGTGCTCGAGGCC
AAGATCGGCAGCAAGTCGGTCGACATCCCGGTCCGCATGGTCGTGGACGCCAGCGGCCGG
CAGACCCGCCTCGGCAACCAGCTCAAGTTCAAGGTCCCGGACCCGATCTTCAACCAGTAC
GCGGTCCACTCGTGGTTCGACAACTTCGACCGCAAGGCCCTGGCGGTCAACAAGGACCAG
GCGGACTACATCTTCATCCACTTCCTGCCGGTCACCGACACCTGGGTGTGGCAGATCCCC
ATCACCGACACCATCACCTCGATCGGTGTGGTCAGCCAGAAGAAGCGGTTCCAGGAGTTC
GCCGGGGACCGGGAGAAGTTCTTCTGGGACACCGTCGCCAGCCGCCCCGAACTGCTCGAC
GCCCTGAAGAACTCGGACCAGGTCCGGCCCTTCAAGACCGAGGGTGACTACAGCTACGGC
ATGTCGCAGATCGCGGGCGACAACTTCGTCCTCATCGGCGACGCGGCCCGCTTCGTGGAC
CCGATCTTCTCCAGCGGTGTGTCCGTGGCGCTCAACAGCGCCCGCCTCGCCTGCAAGGAC
ATCATCGCCGCCGCCGAGGCGGGCGACTTCAAGAAGGAGCGCTTCGGGACCTACGAGCGC
AAGCTGCGCAAGGGCGTCTCGAACTGGTACGAGTTCATCCAGATCTACTACCGGCTCAAC
ATCCTGTTCACCGCGTTCGTCCAGGACGACCGGTACCGCCTGGACGTGCTGAAGATGCTC
CAGGGCGACGTCTACGACGACGAGGAGCCCAAGGCCCTCGCCGCCATGCGGGAGATCGTC
AAGGCGGTGGAGGACGACCCCACCCACCTGTGGCACCCGTACCTCGGCAGCCTCAAGGCC
CCGTCGGCGAAGCCCCAGTTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [6-28]  1.19999985703101e-07 PR00420 [306-321]  1.19999985703101e-07 PR00420
PR00420   RNGMNOXGNASE
IPR006905 Tryptophan halogenase (Family)
 [6-78]  1.7e-11 PF04820 [112-380]  1.69999999999999e-20 PF04820
PF04820   Trp_halogenase
SignalP No significant hit
TMHMM No significant hit