close all open/close all

CDS information : Pyrlo_00300


close this sectionLocation

Organism
StrainATCC 31673 (=NBRC 14294)
Entry namePyrrolomycin
Contig
Start / Stop / Direction48,838 / 47,945 / - [in whole cluster]
48,838 / 47,945 / - [in contig]
Locationcomplement(47945..48838) [in whole cluster]
complement(47945..48838) [in contig]
TypeCDS
Length894 bp (297 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative phosphopantetheinyl transferase
Product (GenBank)4'-phosphopantetheinyl transferase
Gene
Gene (GenBank)pyr30
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17158935] Cloning and characterization of the pyrrolomycin biosynthetic gene clusters from Actinosporangium vitaminophilum ATCC 31673 and Streptomyces sp. strain UC 11065. (Antimicrob Agents Chemother. , 2007)
Family/Domain
FD
IPR008278

close this sectionSequence

selected fasta
>putative phosphopantetheinyl transferase [4'-phosphopantetheinyl transferase]
MASTRAVIHPFGNPPAQQPAVAEPVRVRGTAGPWDRVRHDLASLGWAVLHARIDDWLPHP
AHTPSLKRLLGRDWERYLRMRNPRVRARFAATRSLLKHAAGVAVQAPPHTVELAYTAFGR
PYLRGLDQVDVSLSHTGDFLLVGLTTRGRIGVDAEKIDRPLLRNGTERHICTPYELDMLE
RVPEARRNRSAVRLWTLKEAYSKAIGQGLRFRFSEFGFGEDGQPVRVQRPDGTPGTGSEW
TFATFTPDQQYCASVAVHDTGFGAPADTAAATMLDSGLVDAVNELVARARSEQRAAA
selected fasta
>putative phosphopantetheinyl transferase [4'-phosphopantetheinyl transferase]
ATGGCCAGCACGCGCGCCGTCATCCATCCGTTCGGCAACCCACCCGCCCAGCAACCGGCG
GTGGCGGAGCCGGTGCGGGTGCGCGGGACCGCGGGGCCGTGGGACCGGGTCCGACACGAC
CTGGCCTCGCTGGGTTGGGCGGTGCTGCACGCGCGGATCGACGACTGGCTGCCGCACCCC
GCGCACACGCCCTCCCTGAAGCGGCTGCTGGGCCGGGACTGGGAGCGCTACCTGCGGATG
CGCAACCCCAGGGTCCGGGCCCGGTTCGCCGCCACCCGCTCCCTGCTCAAGCACGCCGCG
GGCGTCGCCGTCCAGGCGCCCCCGCACACCGTGGAGCTGGCCTACACCGCGTTCGGCCGT
CCCTATCTGCGCGGCCTCGACCAGGTGGACGTCAGCCTCAGCCACACCGGTGACTTCCTG
CTGGTGGGGCTGACGACCCGGGGCCGCATCGGGGTGGACGCGGAGAAGATCGACCGCCCG
CTGCTGCGCAACGGCACCGAGCGGCACATCTGCACCCCGTACGAGCTGGACATGCTGGAA
CGGGTCCCCGAGGCCCGGCGGAACCGCAGCGCGGTGCGGCTGTGGACGCTCAAGGAGGCG
TACAGCAAGGCCATCGGGCAGGGTCTGCGGTTCCGTTTCTCCGAGTTCGGGTTCGGGGAG
GACGGACAACCGGTGCGGGTGCAGCGTCCGGACGGCACCCCGGGCACCGGAAGCGAGTGG
ACGTTCGCCACGTTCACGCCCGACCAGCAGTACTGCGCCAGCGTGGCGGTCCACGACACG
GGGTTCGGCGCCCCGGCTGACACCGCCGCGGCGACGATGCTGGACTCGGGCCTGGTGGAC
GCGGTCAACGAGTTGGTCGCCCGGGCCAGGAGCGAGCAGCGGGCCGCGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR008278 4'-phosphopantetheinyl transferase (Domain)
 [149-258]  2.5e-18 G3DSA:3.90.470.20
G3DSA:3.90.470.20   G3DSA:3.90.470.20
 [46-154]  3.1999989904635e-21 SSF56214 [148-260]  2.800005042611e-23 SSF56214
SSF56214   4-PPT_transf
 [149-256]  1.1e-15 PF01648
PF01648   ACPS
SignalP
 [1-22]  0.076 Signal
Eukaryota   
 [1-22]  0.165 Signal
Bacteria, Gram-positive   
TMHMM No significant hit