close all open/close all

CDS information : Pyrlo_00310


close this sectionLocation

Organism
StrainATCC 31673 (=NBRC 14294)
Entry namePyrrolomycin
Contig
Start / Stop / Direction50,828 / 49,044 / - [in whole cluster]
50,828 / 49,044 / - [in contig]
Locationcomplement(49044..50828) [in whole cluster]
complement(49044..50828) [in contig]
TypeCDS
Length1,785 bp (594 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative acyl-CoA dehydrogenase
Product (GenBank)acyl-CoA dehydrogenase
Gene
Gene (GenBank)pyr31
EC number1.3.99.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17158935] Cloning and characterization of the pyrrolomycin biosynthetic gene clusters from Actinosporangium vitaminophilum ATCC 31673 and Streptomyces sp. strain UC 11065. (Antimicrob Agents Chemother. , 2007)
Related Reference
ACC
Q4H1D1
PmId
[15942003] An acyl-CoA dehydrogenase is involved in the formation of the Delta cis3 double bond in the acyl residue of the lipopeptide antibiotic friulimicin in Actinoplanes friuliensis. (Microbiology. , 2005)

close this sectionSequence

selected fasta
>putative acyl-CoA dehydrogenase [acyl-CoA dehydrogenase]
MTVIGTAAAGALNAAGAPSRRAAAGERAAALESYLGDPADFTNPLGHEALLAADARGELS
GEGERLLGRFHLNAEFVPRRLGGRFDGPEGLVRVLRPVFRRDASLAIGYGLSSFLAAVTS
WLEGAPEQQRATADLLLRGERMAVAHPELAHGNDLARDEFRATDTGTRLVLDGTKRAINN
VARARALTVYARTSPAPGRRSHSVLLLDTEEIPAARLTHLPRHPTTGARGLYFHGISFNE
LPVARSALVGEVGQGMELALRSFQISRGVMPSTAIAMIDTCLRTAVRCADERGRASGSGI
DMRNAQQVLAAALADLLLCDSLCLAATRAVNLLPEQTGVYAAAAEYLVPKVLGETAYDLS
IILGSSLYDQRGPYGIFAKQVRDLPVVSLGHAGSAACQATIIPQLPLLADRAWFDAEPAP
AGLFDIGGSLPQLHLEALRPAAGEDALAASLVATARERPGASAGGAAAHRLAEGFLRELC
SLRARISRAGAADRTPVVVAEMSALTDRYTHVLAAASCLGVWRQQQRASPGGFLAEPAWV
VTALARIAGRLGGVPGLTDHAELAAPHEERLATEVVARYRDPRGYDLYGAALAG
selected fasta
>putative acyl-CoA dehydrogenase [acyl-CoA dehydrogenase]
ATGACCGTGATCGGGACAGCGGCTGCCGGGGCGCTGAACGCTGCCGGAGCACCCTCCCGA
CGGGCCGCCGCCGGCGAGCGCGCCGCCGCCCTCGAGTCCTACCTCGGCGACCCCGCAGAC
TTCACCAACCCCCTGGGGCACGAGGCCCTGCTCGCCGCCGACGCCCGGGGCGAACTGTCC
GGCGAGGGCGAGCGACTGCTCGGCCGCTTCCACCTCAACGCGGAGTTCGTCCCCCGTCGA
CTCGGCGGACGGTTCGACGGCCCCGAGGGCCTGGTGCGGGTGCTGCGCCCGGTGTTCCGC
AGGGACGCCTCGCTGGCCATCGGCTACGGCCTCTCGTCCTTCCTCGCCGCGGTCACCTCC
TGGCTCGAGGGCGCGCCCGAGCAGCAGCGGGCCACCGCGGACCTGCTGCTGCGCGGAGAG
CGGATGGCCGTGGCCCACCCCGAACTGGCCCACGGCAACGACCTGGCCAGGGACGAGTTC
CGCGCCACCGACACCGGCACCCGGCTGGTCCTCGACGGCACCAAGCGGGCCATCAACAAC
GTGGCGCGGGCGCGGGCCCTGACCGTCTACGCCAGGACCTCACCCGCCCCCGGCCGTCGC
AGCCACTCGGTGCTGCTGCTGGACACCGAGGAGATCCCCGCGGCACGCCTGACCCACCTG
CCCAGGCACCCCACCACCGGCGCCCGCGGTCTGTACTTCCACGGCATCAGCTTCAACGAG
CTGCCGGTGGCCAGGTCCGCCCTGGTGGGCGAGGTCGGGCAGGGCATGGAACTGGCCCTG
CGCTCCTTCCAGATCAGCCGCGGGGTGATGCCCTCCACGGCCATCGCCATGATCGACACC
TGTCTGCGGACCGCCGTGCGGTGCGCCGACGAGCGGGGTCGCGCCTCCGGTTCCGGGATC
GACATGCGCAACGCCCAGCAGGTGCTCGCCGCCGCCCTGGCCGACCTGCTGCTCTGCGAC
AGCCTGTGCCTGGCGGCCACCCGTGCGGTGAACCTGCTGCCGGAGCAGACCGGGGTGTAC
GCGGCCGCGGCGGAGTACCTGGTGCCCAAGGTCCTCGGCGAGACCGCCTACGACCTGTCG
ATCATCCTGGGCTCCTCGCTGTACGACCAGCGCGGTCCCTACGGCATCTTCGCCAAGCAG
GTGCGTGACCTGCCGGTGGTCAGTCTGGGCCACGCCGGGTCCGCGGCCTGCCAGGCCACG
ATCATCCCGCAGTTGCCGCTCCTGGCTGACCGGGCGTGGTTCGACGCGGAACCCGCCCCC
GCCGGGCTGTTCGACATCGGTGGGTCACTGCCCCAGCTCCACCTGGAGGCGCTGCGGCCG
GCCGCGGGCGAGGACGCACTGGCGGCCTCGCTGGTGGCAACGGCCAGGGAACGTCCGGGC
GCGAGCGCGGGGGGAGCCGCCGCGCACCGGCTCGCCGAGGGGTTCCTGCGCGAGCTGTGC
TCGTTGCGTGCCCGGATCAGTAGGGCCGGTGCGGCGGACCGGACCCCCGTCGTGGTGGCC
GAGATGTCCGCGTTGACCGACCGCTACACCCATGTCCTCGCCGCCGCGTCCTGTCTGGGG
GTGTGGCGCCAGCAGCAACGCGCGAGTCCAGGCGGCTTCCTGGCCGAACCCGCCTGGGTG
GTCACCGCCCTGGCCAGGATCGCCGGACGCCTCGGAGGCGTTCCGGGGCTCACCGACCAC
GCGGAGCTGGCCGCGCCCCACGAGGAGCGGTTGGCCACCGAGGTGGTCGCCCGGTACCGC
GACCCGCGGGGCTACGACCTCTACGGGGCGGCGCTCGCCGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006090 Acyl-CoA oxidase/dehydrogenase, type 1 (Domain)
 [253-403]  1.1e-12 PF00441
PF00441   Acyl-CoA_dh_1
IPR006091 Acyl-CoA oxidase/dehydrogenase, central domain (Domain)
 [143-243]  2.6e-11 G3DSA:2.40.110.10
G3DSA:2.40.110.10   Acyl_CoA_DH/ox_M
 [143-193]  1.2e-07 PF02770
PF02770   Acyl-CoA_dh_M
IPR009075 Acyl-CoA dehydrogenase/oxidase C-terminal (Domain)
 [244-373]  9.9e-11 G3DSA:1.20.140.10
G3DSA:1.20.140.10   AcylCoA_DH_1/2_C
 [253-405]  1.39999892049878e-10 SSF47203
SSF47203   AcylCoADH_C_like
IPR009100 Acyl-CoA dehydrogenase/oxidase (Domain)
 [29-253]  5.8999880940569e-31 SSF56645
SSF56645   AcylCoA_dehyd_NM
SignalP
 [1-22]  0.988 Signal
Bacteria, Gram-negative   
 [1-16]  0.672 Signal
Eukaryota   
 [1-24]  0.792 Signal
Bacteria, Gram-positive   
TMHMM No significant hit