close all open/close all

CDS information : Pyrlo_00320


close this sectionLocation

Organism
StrainATCC 31673 (=NBRC 14294)
Entry namePyrrolomycin
Contig
Start / Stop / Direction51,057 / 52,499 / + [in whole cluster]
51,057 / 52,499 / + [in contig]
Location51057..52499 [in whole cluster]
51057..52499 [in contig]
TypeCDS
Length1,443 bp (480 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative homogentisate 1,2-dioxygenase
Product (GenBank)homogentisate 1,2-dioxygenase
Gene
Gene (GenBank)
EC number1.13.11.5
Keyword
Note
  • It is supposed that this ORF is not involved in pyrrolomycin biosynthesis.
Note (GenBank)
  • orf32
Reference
ACC
PmId
[17158935] Cloning and characterization of the pyrrolomycin biosynthetic gene clusters from Actinosporangium vitaminophilum ATCC 31673 and Streptomyces sp. strain UC 11065. (Antimicrob Agents Chemother. , 2007)
Related Reference
ACC
Q9X4F5
PmId
[10220173] Identification of a novel nutrient-deprivation-induced Sinorhizobium meliloti gene (hmgA) involved in the degradation of tyrosine. (Microbiology. , 1999)

close this sectionSequence

selected fasta
>putative homogentisate 1,2-dioxygenase [homogentisate 1,2-dioxygenase]
MVEHRNQPSPFPSSGTGAHPMSSPSTAAEQAGTPAAGLDYSPGFGNEHVSEAVPGALPVG
RNSPQRAPLGLYAEQLSGTAFTEPRHANRRSWLYRIRPSAAHPRFRRTDNGALLSAPFTD
SEPDPNRLRWDPLPLPERDTDFVTGLYTVGGNGDVLRRCGIGIHLYRANRSMVDRVFVDS
DGELLIVPELGGLLVRTELGLLEARPGQVALVPRGVRFRVELLDGAARGYVCENYGQPFR
LPDLGPIGANGLANPRDFLAPVAAFEDVEEPVEVVNKFGGNLWAAQYDHSPLDVVAWHGN
YAPYVYDLSRFNVLGSISFDHPDPSIFTVLTSPSSTPGLANADFVVFAPRWLVGEDTFRP
AYFHRNVMSEFMGLIDGAYDAKASGFAPGGASLHNMMSAHGPDRDTYAKASSAELLPEKV
DGGTAFMFETRWPVVVTAQAMAADHRQQDYDAVWRDIGRGFPGTAPADGPVRSAGPERTR
selected fasta
>putative homogentisate 1,2-dioxygenase [homogentisate 1,2-dioxygenase]
ATGGTCGAGCATAGGAATCAACCGAGCCCCTTCCCCTCGTCCGGCACAGGAGCGCACCCC
ATGAGCAGCCCCAGCACAGCAGCAGAGCAGGCCGGCACGCCCGCCGCGGGCCTCGACTAC
TCGCCGGGCTTCGGGAACGAGCACGTCAGTGAGGCAGTGCCGGGAGCGTTGCCGGTCGGG
CGGAACTCCCCGCAGCGCGCACCGCTCGGCCTGTACGCCGAGCAGTTGAGCGGTACGGCC
TTCACCGAGCCCCGGCACGCCAACCGCAGGAGCTGGCTGTACCGCATCCGCCCCTCCGCC
GCGCACCCGAGGTTCCGCAGGACCGACAACGGTGCCCTGCTCAGCGCGCCGTTCACCGAC
AGCGAGCCCGACCCGAACCGGCTGCGCTGGGACCCGCTGCCGCTGCCCGAGCGGGACACC
GACTTCGTCACCGGGCTGTACACCGTCGGGGGCAACGGCGACGTGCTGCGCCGCTGCGGC
ATCGGCATCCACCTGTACCGCGCCAACCGCTCCATGGTGGACCGGGTGTTCGTGGACTCC
GACGGGGAGCTGCTGATCGTCCCGGAGCTGGGCGGGCTGCTGGTGCGCACCGAGCTGGGG
CTGCTCGAGGCACGGCCCGGGCAGGTGGCACTGGTGCCCCGCGGGGTGCGGTTCCGGGTG
GAGCTGCTCGACGGGGCGGCGCGGGGCTACGTCTGTGAGAACTACGGTCAGCCGTTCCGG
CTCCCCGACCTGGGGCCGATCGGTGCGAACGGCCTGGCCAACCCCCGGGACTTCCTGGCG
CCCGTGGCGGCCTTCGAGGACGTCGAGGAGCCGGTGGAGGTGGTGAACAAGTTCGGTGGG
AACCTCTGGGCCGCCCAGTACGACCACTCACCGCTCGACGTGGTCGCCTGGCACGGCAAC
TACGCCCCCTACGTCTACGACCTGTCCAGGTTCAACGTCCTCGGCTCGATCAGCTTCGAC
CACCCGGACCCGTCGATCTTCACCGTGCTGACCTCGCCGTCCAGCACGCCCGGCCTGGCC
AACGCCGACTTCGTGGTCTTCGCGCCCCGTTGGCTGGTCGGCGAGGACACCTTCCGGCCG
GCGTACTTCCACCGCAACGTGATGAGCGAGTTCATGGGTCTGATCGACGGCGCCTACGAC
GCCAAGGCCAGCGGGTTCGCGCCGGGCGGGGCCAGCCTGCACAACATGATGAGCGCGCAC
GGGCCCGACCGGGACACCTACGCCAAGGCCAGCAGCGCCGAGCTGCTGCCGGAGAAGGTG
GACGGGGGCACGGCCTTCATGTTCGAGACCCGCTGGCCGGTGGTGGTCACCGCGCAGGCG
ATGGCGGCGGACCACCGGCAGCAGGACTACGACGCCGTCTGGCGGGACATCGGTCGGGGC
TTCCCCGGGACGGCGCCGGCCGACGGGCCCGTCCGGTCGGCGGGGCCGGAGCGGACCAGG
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005708 Homogentisate 1,2-dioxygenase (Family)
 [38-459]  TIGR01015
TIGR01015   HmgA
 [40-457]  PF04209
PF04209   HgmA
IPR011051 RmlC-like cupin domain (Domain)
 [36-467]  SSF51182
SSF51182   RmlC_like_cupin
SignalP
 [1-27]  0.791 Signal
Bacteria, Gram-negative   
TMHMM No significant hit