close all open/close all

CDS information : Pyrlo_00330


close this sectionLocation

Organism
StrainATCC 31673 (=NBRC 14294)
Entry namePyrrolomycin
Contig
Start / Stop / Direction52,496 / 53,248 / + [in whole cluster]
52,496 / 53,248 / + [in contig]
Location52496..53248 [in whole cluster]
52496..53248 [in contig]
TypeCDS
Length753 bp (250 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative GntR family transcriptional regulator
Product (GenBank)GntR-family regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in pyrrolomycin biosynthesis.
Note (GenBank)
  • orf33
Reference
ACC
PmId
[17158935] Cloning and characterization of the pyrrolomycin biosynthetic gene clusters from Actinosporangium vitaminophilum ATCC 31673 and Streptomyces sp. strain UC 11065. (Antimicrob Agents Chemother. , 2007)
Family/Domain
FD
IPR000524

close this sectionSequence

selected fasta
>putative GntR family transcriptional regulator [GntR-family regulator]
MTDGTHQPAPITLNRRLPLWYQVSQSLRASVLGRGPDSPLRLPTEEDLARHYGVSVLTVR
QALKPLEEEGLITRHRRRGTFIDPAARPMAPIRLLGSVDAIVAQQSSEEATVLGRGTAAA
PADLAEHFPPGSGTAWFRRLRRHGGEPSSWAENHVLPELGERVRTEDLERWPMTRVLRDR
LGVRISRITDTVQARLADPETAELLGVPLLSPILHYTGVTYDHENQVVDVARIHYRGDRF
SFSVTLEAES
selected fasta
>putative GntR family transcriptional regulator [GntR-family regulator]
GTGACCGACGGCACCCACCAGCCGGCCCCGATCACCCTGAACCGCAGGTTGCCCCTGTGG
TACCAGGTCTCGCAGAGCCTACGGGCCTCCGTCCTCGGCCGCGGCCCGGACAGCCCGCTG
CGGCTGCCGACCGAGGAGGACCTCGCCCGGCACTACGGCGTCAGCGTGCTCACCGTGCGC
CAGGCGTTGAAGCCGTTGGAGGAGGAGGGCCTGATCACCCGGCACCGGCGGCGGGGCACC
TTCATCGACCCCGCCGCCCGCCCCATGGCACCGATACGGCTGCTGGGTTCCGTGGACGCC
ATCGTGGCCCAGCAGTCGAGTGAGGAGGCGACGGTGCTGGGCCGGGGCACCGCCGCGGCC
CCCGCCGACCTGGCCGAGCACTTCCCGCCGGGCTCCGGGACGGCGTGGTTCCGACGGCTG
CGCCGCCACGGCGGGGAGCCGTCGAGCTGGGCGGAGAACCACGTGCTGCCCGAGCTCGGG
GAGCGGGTGCGCACCGAGGACCTGGAACGCTGGCCGATGACCAGGGTGCTGCGGGACCGG
CTCGGGGTGCGGATCAGCCGGATCACCGACACCGTGCAGGCCCGGCTCGCCGACCCGGAG
ACGGCCGAGCTGCTGGGGGTGCCCCTGCTCAGCCCGATCCTGCACTACACCGGGGTGACC
TACGACCACGAGAACCAGGTGGTGGACGTGGCGCGCATCCACTACCGGGGAGACCGCTTC
TCGTTCTCGGTGACCCTGGAGGCGGAGTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000524 Transcription regulator HTH, GntR (Domain)
 [42-56]  9.30000048475975e-07 PR00035 [56-72]  9.30000048475975e-07 PR00035
PR00035   HTHGNTR
 [23-82]  1.89999859865864e-11 SM00345
SM00345   HTH_GNTR
 [17-85]  PS50949
PS50949   HTH_GNTR
 [40-82]  1.4e-13 PF00392
PF00392   GntR
IPR011663 UbiC transcription regulator-associated (Domain)
 [108-240]  1.9e-29 PF07702
PF07702   UTRA
 [103-241]  5.69999708783953e-27 SM00866
SM00866   UTRA
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [15-84]  3.7e-17 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP No significant hit
TMHMM No significant hit