close all open/close all

CDS information : Pyrlo_00340


close this sectionLocation

Organism
StrainATCC 31673 (=NBRC 14294)
Entry namePyrrolomycin
Contig
Start / Stop / Direction53,341 / 54,492 / + [in whole cluster]
53,341 / 54,492 / + [in contig]
Location53341..54492 [in whole cluster]
53341..54492 [in contig]
TypeCDS
Length1,152 bp (383 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative acyl-CoA dehydrogenase
Product (GenBank)acyl-CoA dehydrogenase
Gene
Gene (GenBank)
EC number1.3.99.-
Keyword
Note
  • It is supposed that this ORF is not involved in pyrrolomycin biosynthesis.
Note (GenBank)
  • orf34
Reference
ACC
PmId
[17158935] Cloning and characterization of the pyrrolomycin biosynthetic gene clusters from Actinosporangium vitaminophilum ATCC 31673 and Streptomyces sp. strain UC 11065. (Antimicrob Agents Chemother. , 2007)
Related Reference
ACC
P28330
PmId
[8155643] Identification of the catalytic base in long chain acyl-CoA dehydrogenase. (Biochemistry. , 1994)

close this sectionSequence

selected fasta
>putative acyl-CoA dehydrogenase [acyl-CoA dehydrogenase]
MRRTVFNDDHEAFRETVRAFLTKEVVPQYAQWEQLGHPPREFYRRMGALGLLGIAVPEEF
GGGGASGLRFSAVLSEETARHGVTLGASRVHSDLVLPYLLEYATPEQKQRWLPGFASGDL
MTAIAMTEPGTGSDLAGITTTARRDGDVYVLNGSKTFITGGALADLVLVVCRTAPRQDGD
RRAGLSILVVEATSPGFSVGRKLEKIGLRTQDTAELFFDEVRVPAANLLGEEGEAFGYLS
HNLVQERLAIVIGAVTAAAAAVEMTVEYVRQREVFGKPLSSFQNTKFVLAECAAEVEAGQ
VLMDRAIEEHERGELSHADVAKAKLFCTEMEGRVIDKCLQLHGGYGYMLEYPIARLYADA
RVHRVYGGTSEVQKSIVGKSLGL
selected fasta
>putative acyl-CoA dehydrogenase [acyl-CoA dehydrogenase]
GTGCGCCGCACCGTGTTCAACGATGACCACGAGGCATTCCGGGAGACCGTCCGGGCGTTC
CTCACCAAGGAGGTCGTCCCGCAGTACGCGCAGTGGGAGCAGCTCGGCCACCCTCCCCGT
GAGTTCTACCGACGGATGGGCGCGCTGGGGCTCCTGGGCATCGCGGTCCCCGAGGAGTTC
GGCGGTGGCGGGGCCAGCGGGCTGAGGTTCAGCGCCGTGCTCTCCGAGGAGACCGCCCGG
CACGGAGTCACCCTGGGCGCCAGCCGGGTCCACTCCGACCTGGTCCTGCCGTACCTGTTG
GAGTACGCCACCCCCGAGCAGAAGCAGCGGTGGCTGCCGGGCTTCGCCAGCGGCGACCTG
ATGACCGCGATCGCCATGACGGAGCCGGGGACCGGGTCCGACCTGGCCGGGATCACCACC
ACCGCCCGCCGGGACGGCGACGTCTACGTGCTCAACGGCTCCAAGACGTTCATCACCGGC
GGGGCCCTCGCCGACCTGGTGCTGGTGGTCTGCCGCACCGCCCCGCGGCAGGACGGCGAC
CGTCGGGCCGGGCTGAGCATCCTGGTGGTGGAGGCCACGTCCCCGGGTTTCAGCGTCGGC
CGGAAGCTGGAGAAGATCGGCTTGCGCACCCAGGACACCGCGGAGCTGTTCTTCGACGAG
GTGCGGGTGCCCGCGGCCAACCTCCTGGGCGAGGAGGGCGAGGCGTTCGGCTACCTCTCC
CACAACCTGGTGCAGGAACGACTCGCCATCGTCATCGGAGCGGTGACCGCCGCCGCGGCG
GCGGTGGAGATGACCGTGGAGTACGTCCGCCAGCGCGAGGTGTTCGGCAAGCCGCTGTCC
TCGTTCCAGAACACCAAGTTCGTGCTCGCCGAGTGCGCCGCCGAGGTGGAGGCCGGTCAG
GTGCTGATGGACCGGGCGATCGAGGAGCACGAGCGCGGGGAGCTGAGCCACGCGGACGTG
GCCAAGGCCAAGCTGTTCTGCACCGAGATGGAGGGCCGCGTGATCGACAAGTGCCTCCAG
CTCCACGGGGGGTACGGCTACATGCTCGAGTACCCGATCGCCCGGCTGTACGCCGACGCC
CGGGTGCACCGGGTGTACGGCGGGACCAGCGAGGTGCAGAAGTCCATCGTCGGCAAGTCG
CTGGGCCTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006089 Acyl-CoA dehydrogenase, conserved site (Conserved_site)
 [340-359]  PS00073
PS00073   ACYL_COA_DH_2
IPR006090 Acyl-CoA oxidase/dehydrogenase, type 1 (Domain)
 [236-381]  1.99999999999999e-41 PF00441
PF00441   Acyl-CoA_dh_1
IPR006091 Acyl-CoA oxidase/dehydrogenase, central domain (Domain)
 [123-173]  1.3e-22 PF02770
PF02770   Acyl-CoA_dh_M
 [123-221]  8.89999999999994e-40 G3DSA:2.40.110.10
G3DSA:2.40.110.10   Acyl_CoA_DH/ox_M
IPR006092 Acyl-CoA dehydrogenase, N-terminal (Domain)
 [7-119]  1e-30 PF02771
PF02771   Acyl-CoA_dh_N
IPR009075 Acyl-CoA dehydrogenase/oxidase C-terminal (Domain)
 [233-381]  7.40000780398343e-47 SSF47203
SSF47203   AcylCoADH_C_like
 [222-381]  8.30000000000004e-57 G3DSA:1.20.140.10
G3DSA:1.20.140.10   AcylCoA_DH_1/2_C
IPR009100 Acyl-CoA dehydrogenase/oxidase (Domain)
 [3-246]  3.30001976117415e-80 SSF56645
SSF56645   AcylCoA_dehyd_NM
IPR013786 Acyl-CoA dehydrogenase/oxidase, N-terminal (Domain)
 [5-120]  5.40000000000002e-36 G3DSA:1.10.540.10
G3DSA:1.10.540.10   AcylCoA_DH/ox_N
SignalP No significant hit
TMHMM No significant hit