close all open/close all
Pyrlo_00340 Pyrlo_00340   last last

CDS information : Pyrlo_00350


close this sectionLocation

Organism
StrainATCC 31673 (=NBRC 14294)
Entry namePyrrolomycin
Contig
Start / Stop / Direction54,492 / 55,655 / + [in whole cluster]
54,492 / 55,655 / + [in contig]
Location54492..55655 [in whole cluster]
54492..55655 [in contig]
TypeCDS
Length1,164 bp (387 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative alpha-methylacyl-CoA racemase
Product (GenBank)L-carnitine dehydratase
Gene
Gene (GenBank)
EC number5.1.99.4
Keyword
Note
  • It is supposed that this ORF is not involved in pyrrolomycin biosynthesis.
Note (GenBank)
  • orf35
Reference
ACC
PmId
[17158935] Cloning and characterization of the pyrrolomycin biosynthetic gene clusters from Actinosporangium vitaminophilum ATCC 31673 and Streptomyces sp. strain UC 11065. (Antimicrob Agents Chemother. , 2007)
Related Reference
ACC
Q5W8V4
PmId
[15489432] Role of alpha-methylacyl coenzyme A racemase in the degradation of methyl-branched alkanes by Mycobacterium sp. strain P101. (J Bacteriol. , 2004)

close this sectionSequence

selected fasta
>putative alpha-methylacyl-CoA racemase [L-carnitine dehydratase]
MGTDTEGAPGRGGPLAGVRVLELGGIGPGPFCGMVLADMGADVIRVERPGDRGALAMPVL
LRGRRSVALDLKDPVAARAVRSIAERCDALIEGFRPGVTERLGLGPEELCQANPRLVYAR
MTGWGQDGPHAQAPGHDINYLALSGALHTFGPADGDPVPPLNLVADFGGGGMLLALGVVS
ALLRAQRDGRGQVVDASMVDGTALLLAMTYGFLANGLWTDQRGVNLLDGSGPFYRVYRCR
DQRHVAVGCLEEQFRADLLRVLGLTDDPDFATPDDRKNWPVMNQRLEQIFTSRTRDNWAA
LFEGTQACVTPVLSLNEAAAHPHNLARGTYLAGPTGIVQPSPAPRFGGTPSDAPRAAPTP
GEHTAEVLAEAGLTSAEIAALTPEPGR
selected fasta
>putative alpha-methylacyl-CoA racemase [L-carnitine dehydratase]
ATGGGCACCGACACCGAAGGGGCCCCGGGCCGGGGGGGCCCGCTCGCCGGGGTGCGGGTG
CTGGAACTCGGCGGCATCGGCCCGGGACCGTTCTGCGGCATGGTCCTCGCCGACATGGGC
GCCGACGTCATCAGGGTGGAGCGCCCCGGGGACCGCGGCGCGCTGGCCATGCCGGTGCTG
CTGCGGGGACGCCGTTCCGTCGCCCTGGACCTGAAGGACCCCGTCGCGGCACGAGCGGTC
CGCAGCATCGCCGAGCGCTGCGACGCGCTGATCGAGGGGTTCCGGCCGGGGGTGACCGAG
CGGCTCGGGCTCGGGCCGGAGGAGCTGTGCCAGGCCAACCCCCGCCTGGTGTACGCCCGG
ATGACCGGCTGGGGGCAGGACGGCCCGCACGCCCAGGCGCCCGGTCACGACATCAACTAC
CTGGCGCTCTCGGGGGCGCTGCACACCTTCGGCCCCGCGGACGGTGACCCCGTTCCCCCG
TTGAACCTGGTCGCCGACTTCGGCGGCGGAGGCATGCTGCTCGCCCTCGGCGTGGTCAGC
GCCCTGCTCCGGGCCCAGCGTGACGGCCGGGGCCAGGTGGTGGACGCCTCCATGGTGGAC
GGGACCGCCCTGCTGCTCGCCATGACCTACGGCTTCCTCGCCAACGGGCTGTGGACCGAC
CAGCGCGGGGTCAACCTGCTCGACGGCAGCGGCCCCTTCTACCGGGTCTACCGGTGCCGT
GACCAGCGCCACGTGGCGGTGGGCTGCCTCGAGGAGCAGTTCCGCGCCGACCTGCTGCGG
GTCCTCGGCCTCACCGACGACCCGGACTTCGCGACCCCGGACGACCGGAAGAACTGGCCG
GTGATGAACCAGCGCCTGGAGCAGATCTTCACCAGCCGCACCCGCGACAACTGGGCCGCC
CTGTTCGAGGGCACCCAGGCGTGCGTCACCCCGGTGCTGTCCCTGAACGAGGCCGCGGCG
CACCCGCACAACCTCGCGCGCGGCACCTACCTCGCCGGCCCCACCGGGATCGTCCAACCC
AGCCCCGCGCCGCGGTTCGGGGGGACGCCGAGCGACGCGCCGAGGGCCGCGCCCACACCC
GGCGAACACACCGCGGAGGTGCTGGCCGAAGCGGGGCTCACCAGTGCGGAGATCGCTGCC
CTGACCCCGGAGCCGGGCCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003673 CoA-transferase family III (Family)
 [67-257]  2.1e-54 PF02515
PF02515   CoA_transf_3
IPR023606 CoA-transferase family III domain (Domain)
 [11-385]  3.30001976117415e-118 SSF89796
SSF89796   CoA-Trfase_fam_III
 [11-311]  1.5e-101 G3DSA:3.40.50.10540
G3DSA:3.40.50.10540   CoA-Trfase_fam_III
SignalP No significant hit
TMHMM No significant hit
Pyrlo_00340 Pyrlo_00340   last last