close all open/close all
first first   R1128_00020 R1128_00020

CDS information : R1128_00010


close this sectionLocation

Organism
StrainR1128
Entry nameR1128
Contig
Start / Stop / Direction1,623 / 376 / - [in whole cluster]
1,623 / 376 / - [in contig]
Locationcomplement(376..1623) [in whole cluster]
complement(376..1623) [in contig]
TypeCDS
Length1,248 bp (415 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productputative polyketide synthase chain length factor subunit
Product (GenBank)chain length factor
Gene
Gene (GenBank)zhuA
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[10931852] Cloning, nucleotide sequence, and heterologous expression of the biosynthetic gene cluster for R1128, a non-steroidal estrogen receptor antagonist. Insights into an unusual priming mechanism. (J Biol Chem. , 2000)
Related Reference
ACC
Q02062
NITE
Actino_00190
PmId
[10519556] A chain initiation factor common to both modular and aromatic polyketide synthases. (Nature. , 1999)
[10684659] Mechanistic analysis of a type II polyketide synthase. Role of conserved residues in the beta-ketoacyl synthase-chain length factor heterodimer. (Biochemistry. , 2000)
[15286722] An antibiotic factory caught in action. (Nat Struct Mol Biol. , 2004)
[18034463] Dissecting the component reactions catalyzed by the actinorhodin minimal polyketide synthase. (Biochemistry. , 2007)

close this sectionPKS/NRPS Module

CLF9..368

close this sectionSequence

selected fasta
>putative polyketide synthase chain length factor subunit [chain length factor]
MTQAAPTTRRAVVTGLGAVAPNGFGTEEYWKATLRGRSGIHPLHRYDASGFPSRLAGQIL
GFEAEQHIPGRLLPQTDRVTRLALVAGQSALDDAGVDPQALVDYSMGVVTSSAIGGFEFT
HGEVHKLWTKGPQHVSVYESFAWFYAVNTGQLSIRHGMRGPSGVLVGEQAGGLDAIGHAR
RNLRRGIDLVVTGGCDSALDPWGYVSHLTTGRISRATEPELAYRPFDAAADGYVPGEGGA
ILVLEDERAARARGAATLYGEIAGYAATFDPPPGSERPPGLARAARLALDDAGVRPEDVD
AVFADAAGVPDLDRAEAEAINEVFGAGAVPVTAPKSLVGRLNSGGPPLDVVAALLSIRDD
VVPPTPNTTDVPADYGLDLVLSEPRNARVRTVLVLARGHGGFNAAVVVRAMNPEL
selected fasta
>putative polyketide synthase chain length factor subunit [chain length factor]
ATGACCCAGGCAGCCCCCACGACGCGGCGCGCCGTCGTCACCGGCCTCGGCGCCGTTGCC
CCCAACGGCTTCGGCACCGAGGAGTACTGGAAGGCCACGCTGCGCGGACGCTCCGGCATC
CACCCGCTGCACCGCTACGACGCGTCCGGATTCCCGTCCCGACTCGCCGGCCAGATACTC
GGCTTCGAGGCCGAACAGCACATTCCGGGAAGGCTGTTGCCGCAGACCGACCGCGTCACG
CGACTCGCCCTCGTCGCCGGCCAGAGCGCGCTCGACGACGCCGGCGTCGACCCGCAGGCA
CTCGTCGACTACTCGATGGGCGTCGTCACCTCCAGCGCCATCGGCGGCTTCGAGTTCACC
CACGGCGAGGTACACAAGCTCTGGACCAAGGGACCGCAACACGTCAGCGTCTACGAGTCG
TTCGCGTGGTTCTACGCCGTCAACACCGGCCAGTTGTCCATCCGGCACGGCATGCGCGGG
CCCAGCGGCGTCCTGGTCGGCGAACAAGCCGGCGGCCTCGACGCCATCGGCCACGCGCGC
CGCAACCTGCGGCGCGGCATCGACCTCGTGGTCACCGGCGGATGCGACTCGGCGCTCGAC
CCGTGGGGATACGTCAGCCACCTGACCACCGGACGGATCTCCCGCGCGACCGAACCCGAG
CTGGCCTACCGGCCGTTCGACGCGGCCGCCGACGGCTACGTGCCGGGGGAGGGCGGGGCC
ATCCTCGTCCTGGAGGACGAACGCGCCGCCCGGGCCCGGGGCGCGGCCACGCTCTACGGC
GAGATCGCAGGCTACGCGGCCACCTTCGACCCGCCGCCCGGCTCCGAACGGCCGCCGGGG
CTGGCCCGCGCGGCCCGCCTCGCGCTCGACGACGCGGGCGTGCGGCCCGAGGACGTGGAC
GCGGTGTTCGCGGACGCGGCCGGCGTACCGGACCTGGACCGCGCCGAAGCCGAGGCGATC
AACGAGGTGTTCGGGGCCGGCGCGGTGCCGGTGACGGCGCCCAAGAGCCTGGTGGGACGC
CTCAACTCGGGCGGGCCGCCGCTCGACGTGGTGGCCGCGCTGTTGTCGATCCGCGACGAC
GTCGTCCCGCCGACGCCCAACACCACCGACGTGCCGGCCGACTACGGGCTCGACCTCGTG
CTGTCCGAACCGCGCAACGCGCGCGTGCGGACGGTGCTGGTGCTGGCCCGCGGCCACGGC
GGGTTCAACGCGGCCGTCGTGGTCCGCGCGATGAACCCCGAACTGTAG
CLF9..368
CLF25..1104

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [9-249]  8.00000000000001e-55 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [259-368]  7.79999999999999e-25 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [7-264]  1.40000000000001e-56 G3DSA:3.40.47.10 [275-413]  2.1e-38 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [8-255]  8.19994104549873e-65 SSF53901 [218-411]  1e-49 SSF53901
SSF53901   Thiolase-like
SignalP
 [1-11]  0.45 Signal
Bacteria, Gram-negative   
 [1-25]  0.528 Signal
Eukaryota   
TMHMM No significant hit
first first   R1128_00020 R1128_00020