close all open/close all

CDS information : R1128_00020


close this sectionLocation

Organism
StrainR1128
Entry nameR1128
Contig
Start / Stop / Direction2,873 / 1,620 / - [in whole cluster]
2,873 / 1,620 / - [in contig]
Locationcomplement(1620..2873) [in whole cluster]
complement(1620..2873) [in contig]
TypeCDS
Length1,254 bp (417 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productputative polyketide synthase beta-ketoacyl synthase subunit
Product (GenBank)beta-ketoacylsynthase I
Gene
Gene (GenBank)zhuB
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[10931852] Cloning, nucleotide sequence, and heterologous expression of the biosynthetic gene cluster for R1128, a non-steroidal estrogen receptor antagonist. Insights into an unusual priming mechanism. (J Biol Chem. , 2000)
Related Reference
ACC
Q02059
NITE
Actino_00180
PmId
[10519556] A chain initiation factor common to both modular and aromatic polyketide synthases. (Nature. , 1999)
[10684659] Mechanistic analysis of a type II polyketide synthase. Role of conserved residues in the beta-ketoacyl synthase-chain length factor heterodimer. (Biochemistry. , 2000)
[15286722] An antibiotic factory caught in action. (Nat Struct Mol Biol. , 2004)
[18034463] Dissecting the component reactions catalyzed by the actinorhodin minimal polyketide synthase. (Biochemistry. , 2007)

close this sectionPKS/NRPS Module

KS2..369

close this sectionSequence

selected fasta
>putative polyketide synthase beta-ketoacyl synthase subunit [beta-ketoacylsynthase I]
MITGMGVVAPGGTGTKGFWDLLTSGRTATRRISHFDPSPFRSQVAAECDFDPVLAGFTHR
EIRRLDRASLFAVASARDCAADSGLAFADLDPTRIGVSVGSAVGATTSLEREYLVLSDSG
RDWVVDADYATPHMYDYFTPGAIAAEVAWSVGAEGPATIVSSGCTSGLDSVGYAYQLIVE
GTADIMVTGATDAPISPIAVACFDAIKATTPRNDEPESASRPFDLTRSGFVIGEGAAMFV
LEEYEHAKARGAHIYAEVTGYATRCNAYHMTGLKADGREMADAITYALNESRIDPTAVDY
INAHGSGTKQNDRHETNAFKVALGDHAYDVPVSSIKSMIGHSLGAIGSIEIAASVLAIQH
NVVPPTANLTQSDPECDLDYVPVTAREHRTDTVLSVGSGFGGFQSAMVLRRLQEDAR
selected fasta
>putative polyketide synthase beta-ketoacyl synthase subunit [beta-ketoacylsynthase I]
GTGATCACCGGGATGGGGGTCGTGGCCCCGGGCGGCACCGGAACCAAGGGGTTCTGGGAC
CTGCTCACCTCAGGCCGCACCGCCACCCGGCGCATCTCCCACTTCGACCCGTCGCCGTTC
CGGTCCCAGGTGGCCGCGGAATGCGACTTCGACCCGGTCCTGGCCGGCTTCACGCACCGC
GAGATCCGCCGCCTGGACCGCGCGTCGCTGTTCGCCGTCGCCAGCGCGCGGGACTGCGCC
GCCGACAGCGGACTGGCGTTCGCCGACCTCGACCCGACCCGGATCGGAGTCAGCGTCGGC
AGCGCCGTCGGCGCCACCACGAGCCTCGAACGCGAATACCTCGTGCTCTCCGACTCCGGA
CGCGACTGGGTGGTCGACGCCGACTACGCCACGCCGCACATGTACGACTACTTCACGCCC
GGCGCGATCGCCGCCGAAGTGGCCTGGAGCGTCGGCGCGGAGGGCCCCGCGACCATCGTG
TCCTCCGGCTGCACCTCGGGCCTGGACTCGGTCGGCTACGCCTACCAGCTCATCGTCGAG
GGCACCGCCGACATCATGGTCACCGGCGCCACCGACGCGCCGATCTCGCCGATCGCCGTC
GCGTGCTTCGACGCCATCAAGGCCACCACCCCGCGCAACGACGAACCCGAGTCCGCGTCG
AGGCCGTTCGACCTGACCCGCAGCGGATTCGTGATCGGCGAGGGGGCGGCGATGTTCGTC
CTCGAGGAGTACGAGCACGCCAAGGCGCGCGGCGCGCACATCTACGCCGAGGTCACCGGC
TACGCGACCCGCTGCAACGCGTACCACATGACCGGACTCAAGGCCGACGGACGGGAGATG
GCCGACGCCATCACCTACGCGCTGAACGAATCGCGCATCGACCCGACGGCGGTGGACTAC
ATCAACGCCCACGGGTCCGGGACCAAGCAGAACGACCGGCACGAGACCAACGCGTTCAAG
GTCGCCCTCGGCGACCACGCCTACGACGTCCCGGTCAGCTCCATCAAGTCGATGATCGGG
CACTCGCTCGGCGCGATCGGCTCCATCGAGATCGCCGCCAGCGTCCTCGCGATCCAGCAC
AACGTCGTGCCGCCGACCGCGAACCTGACCCAGTCCGACCCCGAATGCGACCTGGACTAC
GTGCCGGTGACCGCCCGCGAACACCGCACCGACACCGTGCTGTCGGTCGGCAGCGGCTTC
GGTGGCTTCCAGAGCGCGATGGTGCTGCGCCGCCTTCAGGAGGACGCGCGATGA
KS2..369
KS4..1107

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [2-246]  4.6e-55 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [255-369]  6.6999999999999e-38 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [2-260]  6.19999999999994e-62 G3DSA:3.40.47.10 [265-414]  3.29999999999997e-52 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [1-252]  1.99999636034521e-62 SSF53901 [214-412]  3.49999466863949e-64 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [155-171]  PS00606
PS00606   B_KETOACYL_SYNTHASE
SignalP No significant hit
TMHMM No significant hit