close all open/close all

CDS information : R1128_00030


close this sectionLocation

Organism
StrainR1128
Entry nameR1128
Contig
Start / Stop / Direction3,067 / 4,113 / + [in whole cluster]
3,067 / 4,113 / + [in contig]
Location3067..4113 [in whole cluster]
3067..4113 [in contig]
TypeCDS
Length1,047 bp (348 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productacyl-ACP thioesterase
Product (GenBank)acyl transferase
Gene
Gene (GenBank)zhuC
EC number
Keyword
  • type II thioesterase
  • non-acetate starter unit
Note
Note (GenBank)
Reference
ACC
PmId
[10931852] Cloning, nucleotide sequence, and heterologous expression of the biosynthetic gene cluster for R1128, a non-steroidal estrogen receptor antagonist. Insights into an unusual priming mechanism. (J Biol Chem. , 2000)
[15260498] The acyltransferase homologue from the initiation module of the R1128 polyketide synthase is an acyl-ACP thioesterase that edits acetyl primer units. (Biochemistry. , 2004)
Related Reference
ACC
Q9KHK3
NITE
Enter_00120
PmId
[21531566] Policing starter unit selection of the enterocin type II polyketide synthase by the type II thioesterase EncL. (Bioorg Med Chem. , 2011)

close this sectionSequence

selected fasta
>acyl-ACP thioesterase [acyl transferase]
MTIRLVPPRRRVALLLPGQGSQHPGMGLELYGYDGVFTETMDEMFELLGPVDGASLRADW
LAGDALAPELLNDASRAQPLLFAVEYALGRSLLSQGVDVDVLLGHSVGELSAAALAGVVD
LPGAARVMAARTAALAALPPGGMLAVAATAEELAPFVAAEHVEIGVVVGALNAPRQTVLA
GPEPRLTEVEGELRAAGVMFRRVPARQPFHSPASAPAAEVVEKVLSGVTLREPTIPIMST
HSGAYVTREQALDPAFWAWHFVRVVLFWPALDALLSEADHALVELGPGQELTVLARRHKA
VRSGASTVRAVLPRGARGTREAWDDALAELAEYTGPAGGVPLACAAER
selected fasta
>acyl-ACP thioesterase [acyl transferase]
ATGACGATCAGACTGGTTCCGCCGCGCCGCCGTGTCGCCCTGCTGCTGCCGGGGCAGGGC
TCGCAACACCCCGGTATGGGGCTGGAGTTGTACGGCTACGACGGTGTGTTCACCGAGACG
ATGGACGAGATGTTCGAGCTGCTCGGGCCGGTGGACGGCGCGTCGCTGCGCGCCGACTGG
CTGGCCGGCGACGCGCTCGCGCCGGAGCTGCTGAACGACGCGAGCCGCGCGCAGCCGCTG
TTGTTCGCGGTCGAGTACGCGCTGGGCCGCAGCCTGTTGTCGCAGGGCGTCGACGTGGAC
GTGCTGCTCGGGCACAGCGTCGGCGAGTTGTCGGCGGCGGCGTTGGCCGGCGTCGTCGAC
CTGCCGGGCGCGGCGCGCGTGATGGCGGCCCGGACCGCGGCGTTGGCCGCGCTTCCCCCG
GGCGGGATGCTCGCGGTCGCGGCGACCGCCGAGGAGTTGGCGCCGTTCGTGGCCGCCGAG
CACGTCGAGATCGGCGTGGTGGTGGGCGCGTTGAACGCGCCGCGGCAGACCGTACTGGCG
GGGCCCGAGCCGCGGTTGACCGAGGTGGAGGGCGAACTGCGGGCGGCCGGTGTGATGTTC
CGTCGGGTGCCGGCGCGGCAGCCGTTCCACTCCCCCGCGTCGGCGCCGGCCGCCGAGGTG
GTGGAGAAGGTGTTGTCCGGGGTGACGTTGCGCGAGCCGACGATCCCGATCATGTCGACG
CACTCGGGCGCCTACGTGACCCGCGAGCAGGCCCTCGACCCGGCCTTCTGGGCCTGGCAC
TTCGTGCGCGTGGTGTTGTTCTGGCCGGCGTTGGACGCGCTGCTCTCCGAGGCCGACCAC
GCGCTCGTCGAGCTGGGCCCGGGCCAGGAGCTGACGGTGCTGGCGCGCCGGCACAAGGCG
GTCCGGTCGGGCGCCAGCACGGTGCGCGCGGTGTTGCCGCGCGGGGCGCGCGGTACGCGG
GAGGCGTGGGACGACGCGCTGGCCGAACTGGCCGAGTACACCGGGCCGGCCGGGGGTGTG
CCGCTCGCCTGCGCGGCGGAACGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [9-138]  2.99999999999998e-54 G3DSA:3.40.366.10 [207-318]  2.99999999999998e-54 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR014043 Acyl transferase (Domain)
 [16-323]  7.4e-42 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [11-299]  1.49999648196323e-49 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [139-206]  1.69999922284049e-13 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
SignalP
 [1-13]  0.44 Signal
Bacteria, Gram-negative   
TMHMM No significant hit