close all open/close all

CDS information : R1128_00040


close this sectionLocation

Organism
StrainR1128
Entry nameR1128
Contig
Start / Stop / Direction6,207 / 4,822 / - [in whole cluster]
6,207 / 4,822 / - [in contig]
Locationcomplement(4822..6207) [in whole cluster]
complement(4822..6207) [in contig]
TypeCDS
Length1,386 bp (461 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative acetyl-CoA carboxylase biotin carboxylase subunit
Product (GenBank)biotin carboxylase
Gene
Gene (GenBank)zhuD
EC number6.4.1.2
6.3.4.14
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[10931852] Cloning, nucleotide sequence, and heterologous expression of the biosynthetic gene cluster for R1128, a non-steroidal estrogen receptor antagonist. Insights into an unusual priming mechanism. (J Biol Chem. , 2000)
Related Reference
ACC
P49787
PmId
[7592499] The genes encoding the biotin carboxyl carrier protein and biotin carboxylase subunits of Bacillus subtilis acetyl coenzyme A carboxylase, the first enzyme of fatty acid synthesis. (J Bacteriol. , 1995)

close this sectionSequence

selected fasta
>putative acetyl-CoA carboxylase biotin carboxylase subunit [biotin carboxylase]
MFEKVLIANRGEIALRVAATCRELGIRTVVVHSDADRHSAAVRFADEAVCVGPAPPRASY
LNAAAVLQAAVQTGVEAVHPGYGFLSEDPDFAEACEDEGITLIGPPAEVMSRLGNKASAR
SIMSQAGLPLLPGSLDPLSDREAHALADTIGYPVIVKAAAGGGGRGMSVVHSSDDFPDTF
RRTQATALAVFGDGRVYVERYLPEARHVEIQVLADRYGNVVHLGERDCSVQRRHQKLVEE
TPGPRLPDGLAARMGEAAVAGARAVGYVGAGTFEFLLAPDGTFSFMEVNCRIQVEHPVTE
MVTGIDLVREQILVAAGRPLTVRQEDIRPNGVSMECRINAEDPTRGFVPTPGLIDTFTPA
GGPFVRVDTHVHAGYTVPASYDSLLAKLVVWAPDREQALARMRRALDQFEVEGQRVRTTI
GFLREVFDNDKFAAGRHSTSLVDEMLAAEARNARTGVPLSA
selected fasta
>putative acetyl-CoA carboxylase biotin carboxylase subunit [biotin carboxylase]
ATGTTCGAGAAGGTACTCATCGCCAACCGCGGCGAGATCGCGCTGCGTGTCGCCGCGACC
TGTCGGGAGCTCGGCATCCGGACCGTCGTCGTGCACTCCGATGCCGACCGCCACTCCGCC
GCCGTGCGGTTCGCGGACGAGGCCGTGTGCGTCGGCCCCGCCCCGCCGCGCGCCAGCTAC
CTCAACGCCGCCGCCGTGCTCCAGGCCGCCGTGCAGACCGGCGTCGAGGCGGTCCACCCC
GGCTACGGATTCCTGTCCGAGGACCCGGACTTCGCCGAGGCGTGCGAGGACGAGGGCATC
ACCCTCATCGGCCCGCCCGCCGAGGTGATGTCGCGGCTCGGGAACAAGGCGTCCGCCCGG
TCGATCATGTCGCAGGCCGGCCTTCCGCTGCTGCCCGGCAGCCTCGACCCGCTCTCCGAC
CGCGAGGCGCACGCGCTCGCCGACACGATCGGCTACCCCGTCATCGTCAAGGCGGCGGCC
GGCGGCGGCGGGCGCGGCATGTCGGTGGTCCACTCCAGCGACGACTTCCCCGACACGTTC
CGCCGCACCCAGGCCACCGCGTTGGCGGTGTTCGGCGACGGGCGGGTGTACGTCGAGCGC
TACCTGCCCGAGGCCCGGCACGTCGAGATCCAGGTGCTCGCCGACCGCTACGGCAACGTC
GTCCACCTGGGCGAACGCGACTGCTCCGTGCAGCGCCGGCACCAGAAGCTCGTCGAGGAG
ACGCCCGGGCCCCGGCTTCCGGACGGCCTCGCCGCCCGGATGGGCGAGGCGGCCGTCGCC
GGGGCGCGCGCGGTCGGCTACGTCGGCGCCGGCACGTTCGAGTTCCTGCTCGCGCCCGAC
GGAACGTTCTCCTTCATGGAGGTCAACTGCCGTATCCAGGTCGAGCACCCGGTCACAGAG
ATGGTCACCGGCATCGACCTGGTGCGCGAGCAGATCCTGGTCGCCGCCGGCCGTCCGCTG
ACGGTGCGCCAGGAAGACATCCGACCCAACGGCGTGTCCATGGAGTGCCGCATCAACGCC
GAGGACCCGACGCGCGGATTCGTGCCGACGCCAGGGCTGATCGACACGTTCACGCCCGCC
GGCGGCCCGTTCGTGCGCGTCGACACACACGTGCACGCCGGGTACACCGTGCCCGCGTCG
TACGACTCGCTGCTGGCCAAGCTCGTGGTGTGGGCACCGGACCGCGAACAGGCCCTCGCC
CGCATGCGCCGCGCGCTCGACCAGTTCGAGGTCGAGGGCCAACGGGTGCGCACCACCATC
GGGTTCCTGCGCGAGGTGTTCGACAACGACAAGTTCGCCGCCGGACGCCACAGCACCTCC
CTCGTCGACGAGATGCTCGCCGCCGAGGCCCGGAACGCGCGGACGGGAGTGCCCCTGTCC
GCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005479 Carbamoyl-phosphate synthetase large subunit-like, ATP-binding domain (Domain)
 [152-166]  PS00866
PS00866   CPSASE_1
 [116-321]  5.40000000000002e-70 PF02786
PF02786   CPSase_L_D2
IPR005481 Carbamoyl-phosphate synthase, large subunit, N-terminal (Domain)
 [1-110]  8.89999999999994e-43 PF00289
PF00289   CPSase_L_chain
IPR005482 Biotin carboxylase, C-terminal (Domain)
 [335-443]  5.40001756046195e-60 SM00878
SM00878   Biotin_carb_C
 [335-443]  1.70000000000001e-36 PF02785
PF02785   Biotin_carb_C
IPR011054 Rudiment single hybrid motif (Domain)
 [330-446]  1.70000295590053e-42 SSF51246
SSF51246   Rudmnt_hyb_motif
IPR011761 ATP-grasp fold (Domain)
 [120-316]  PS50975
PS50975   ATP_GRASP
IPR011764 Biotin carboxylation domain (Domain)
 [1-447]  PS50979
PS50979   BC
IPR013815 ATP-grasp fold, subdomain 1 (Domain)
 [130-201]  1.2e-25 G3DSA:3.30.1490.20
G3DSA:3.30.1490.20   ATP_grasp_subdomain_1
IPR013816 ATP-grasp fold, subdomain 2 (Domain)
 [204-446]  1.20000000000001e-95 G3DSA:3.30.470.20
G3DSA:3.30.470.20   ATP_grasp_subdomain_2
IPR016185 Pre-ATP-grasp fold (Domain)
 [1-113]  7.79998304125571e-49 SSF52440
SSF52440   PreATP-grasp-like
 [1-129]  4.5e-49 G3DSA:3.40.50.20
G3DSA:3.40.50.20   Pre-ATP_grasp
SignalP No significant hit
TMHMM No significant hit