close all open/close all

CDS information : R1128_00050


close this sectionLocation

Organism
StrainR1128
Entry nameR1128
Contig
Start / Stop / Direction6,651 / 6,214 / - [in whole cluster]
6,651 / 6,214 / - [in contig]
Locationcomplement(6214..6651) [in whole cluster]
complement(6214..6651) [in contig]
TypeCDS
Length438 bp (145 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit
Product (GenBank)biotin carboxylase carrier protein
Gene
Gene (GenBank)zhuE
EC number6.4.1.2
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[10931852] Cloning, nucleotide sequence, and heterologous expression of the biosynthetic gene cluster for R1128, a non-steroidal estrogen receptor antagonist. Insights into an unusual priming mechanism. (J Biol Chem. , 2000)
Related Reference
ACC
P0ABD8
PmId
[8631788] Purification and characterization of intact and truncated forms of the Escherichia coli biotin carboxyl carrier subunit of acetyl-CoA carboxylase. (J Biol Chem. , 1996)
[9398236] Structure of the carboxy-terminal fragment of the apo-biotin carboxyl carrier subunit of Escherichia coli acetyl-CoA carboxylase. (Biochemistry. , 1997)

close this sectionSequence

selected fasta
>putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit [biotin carboxylase carrier protein]
MLEALPERPTRLNVRADGVGIEVSWEAPQAPAVPQPVVSAVPVATVPAVAAPPPVPAPPA
EPTAHQVCAPSVGVFYHATEPGAAPFVRVGDVVRPGQQIGIVEAMKLMLPVEADRPGRVS
AILRANGDQVEYGEPLVALVPVEGA
selected fasta
>putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit [biotin carboxylase carrier protein]
ATGCTCGAAGCGTTGCCCGAGCGGCCCACGCGGCTCAACGTGCGCGCGGACGGCGTCGGG
ATCGAGGTGTCCTGGGAGGCGCCGCAGGCCCCGGCGGTGCCCCAGCCCGTCGTGTCCGCC
GTTCCCGTCGCCACCGTGCCCGCCGTCGCCGCGCCGCCGCCCGTGCCCGCGCCCCCGGCG
GAGCCGACCGCGCACCAGGTGTGCGCGCCCAGCGTCGGCGTGTTCTACCACGCCACCGAG
CCCGGCGCCGCGCCGTTCGTGCGGGTCGGCGACGTGGTCCGCCCCGGTCAACAGATCGGC
ATCGTCGAGGCGATGAAGCTCATGCTCCCCGTCGAGGCCGACCGTCCCGGCCGGGTGTCC
GCGATCCTGCGCGCCAACGGCGACCAGGTCGAGTACGGCGAGCCGCTCGTCGCGCTGGTC
CCCGTGGAAGGCGCGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000089 Biotin/lipoyl attachment (Domain)
 [65-139]  PS50968
PS50968   BIOTINYL_LIPOYL
 [65-138]  1.3e-18 PF00364
PF00364   Biotin_lipoyl
IPR001249 Acetyl-CoA biotin carboxyl carrier (Family)
 [69-82]  4.60000044330862e-12 PR01071 [86-100]  4.60000044330862e-12 PR01071 [101-114]  4.60000044330862e-12 PR01071
PR01071   ACOABIOTINCC
IPR001882 Biotin-binding site (Binding_site)
 [96-113]  PS00188
PS00188   BIOTIN
IPR011053 Single hybrid motif (Domain)
 [61-139]  6.19998763505952e-20 SSF51230
SSF51230   Hybrid_motif
SignalP
 [1-16]  0.076 Signal
Eukaryota   
TMHMM No significant hit