close all open/close all

CDS information : R1128_00070


close this sectionLocation

Organism
StrainR1128
Entry nameR1128
Contig
Start / Stop / Direction9,182 / 8,922 / - [in whole cluster]
9,182 / 8,922 / - [in contig]
Locationcomplement(8922..9182) [in whole cluster]
complement(8922..9182) [in contig]
TypeCDS
Length261 bp (86 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productacyl carrier protein
Product (GenBank)acyl carrier protein
Gene
Gene (GenBank)zhuG
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[10931852] Cloning, nucleotide sequence, and heterologous expression of the biosynthetic gene cluster for R1128, a non-steroidal estrogen receptor antagonist. Insights into an unusual priming mechanism. (J Biol Chem. , 2000)
[11732905] In vitro reconstitution and analysis of the chain initiating enzymes of the R1128 polyketide synthase. (Biochemistry. , 2001)
[12767243] Ketosynthases in the initiation and elongation modules of aromatic polyketide synthases have orthogonal acyl carrier protein specificity. (Biochemistry. , 2003)
[19292437] Biosynthesis of aromatic polyketides in bacteria. (Acc Chem Res. , 2009)

close this sectionPKS/NRPS Module

ACP5..78

close this sectionSequence

selected fasta
>acyl carrier protein [acyl carrier protein]
MDPFTLDDLKRLIDACVGTDDAVQLDETGAATPFLDLGLDSLAVYEVVTRIQDERGVAIS
DDDIDGLETPRDMVAFVNGLLVETAG
selected fasta
>acyl carrier protein [acyl carrier protein]
ATGGACCCCTTCACGCTCGACGACCTCAAGCGGCTGATCGACGCGTGCGTCGGCACCGAC
GACGCGGTCCAGCTCGACGAGACCGGCGCGGCCACCCCGTTCCTGGACCTCGGCCTCGAC
TCGCTCGCCGTCTACGAGGTCGTCACCCGGATCCAGGACGAGCGCGGCGTCGCCATCTCC
GACGACGACATCGACGGCCTGGAGACACCGCGCGACATGGTCGCGTTCGTCAACGGCCTG
CTCGTCGAGACCGCGGGCTGA
ACP5..78
ACP13..234

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009081 Acyl carrier protein-like (Domain)
 [5-82]  2.4e-17 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [5-78]  PS50075
PS50075   ACP_DOMAIN
 [1-86]  9.80000272130218e-15 SSF47336
SSF47336   ACP_like
 [26-77]  3.1e-12 PF00550
PF00550   PP-binding
SignalP No significant hit
TMHMM No significant hit