close all open/close all

CDS information : R1128_00080


close this sectionLocation

Organism
StrainR1128
Entry nameR1128
Contig
Start / Stop / Direction9,448 / 10,467 / + [in whole cluster]
9,448 / 10,467 / + [in contig]
Location9448..10467 [in whole cluster]
9448..10467 [in contig]
TypeCDS
Length1,020 bp (339 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productbeta-ketoacyl synthase
Product (GenBank)beta-ketoacylsynthase III
Gene
Gene (GenBank)zhuH
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[10931852] Cloning, nucleotide sequence, and heterologous expression of the biosynthetic gene cluster for R1128, a non-steroidal estrogen receptor antagonist. Insights into an unusual priming mechanism. (J Biol Chem. , 2000)
[11732905] In vitro reconstitution and analysis of the chain initiating enzymes of the R1128 polyketide synthase. (Biochemistry. , 2001)
[12767243] Ketosynthases in the initiation and elongation modules of aromatic polyketide synthases have orthogonal acyl carrier protein specificity. (Biochemistry. , 2003)
[19292437] Biosynthesis of aromatic polyketides in bacteria. (Acc Chem Res. , 2009)

close this sectionPKS/NRPS Module

KS10..331

close this sectionSequence

selected fasta
>beta-ketoacyl synthase [beta-ketoacylsynthase III]
MPGLRVPERRFSRVLGVGSYRPRREVSNKEVCTWIDSTEEWIETRTGIRSRRIAEPDETI
QVMGVAASRRALEHAGVDPAEIDLVVVSTMTNFVHTPPLSVAIAHELGADNAGGFDLSAA
CAGFCHALSIAADAVESGGSRHVLVVATERMTDVIDLADRSLSFLFGDGAGAAVVGPSDV
PGIGPVVRGIDGTGLGSLHMSSSWDQYVEDPSVGRPALVMDGKRVFRWAVADVVPAAREA
LEVAGLTVGDLVAFVPHQANLRIIDVLVDRLGVPEHVVVSRDAEDTGNTSSASVALALDR
LVRSGAVPGGGPALMIGFGAGLSYAGQALLLPDPPSTPA
selected fasta
>beta-ketoacyl synthase [beta-ketoacylsynthase III]
ATGCCCGGACTTCGGGTTCCCGAGCGGCGTTTCAGCCGTGTTCTCGGGGTCGGTTCGTAC
CGGCCCCGCCGTGAGGTGAGCAACAAGGAGGTGTGCACCTGGATCGACTCGACGGAGGAG
TGGATCGAGACGCGCACCGGGATCAGGTCGCGGCGGATCGCCGAGCCGGACGAGACGATC
CAGGTGATGGGGGTGGCCGCGAGCCGCCGCGCGCTGGAGCACGCCGGCGTGGATCCGGCC
GAGATCGACCTGGTCGTGGTCTCCACGATGACCAACTTCGTGCACACGCCGCCGCTTTCG
GTCGCGATCGCGCACGAGCTGGGTGCCGACAACGCCGGCGGGTTCGACCTGTCGGCGGCG
TGCGCGGGGTTCTGCCACGCGTTGTCGATCGCGGCGGACGCGGTGGAGTCCGGCGGTTCG
CGGCACGTGCTCGTGGTGGCGACGGAGCGGATGACCGACGTGATCGACCTGGCGGACCGG
AGCCTGTCGTTCCTGTTCGGCGACGGCGCCGGCGCGGCCGTGGTCGGCCCGTCCGACGTG
CCCGGCATCGGTCCGGTGGTGCGCGGCATCGACGGCACCGGCCTGGGCTCGCTGCACATG
AGCAGTTCGTGGGACCAGTACGTCGAGGACCCCTCGGTGGGCCGGCCGGCGCTGGTGATG
GACGGCAAGCGGGTGTTCCGCTGGGCGGTCGCGGACGTCGTCCCGGCGGCCCGCGAGGCG
CTCGAGGTGGCCGGCCTGACCGTCGGGGACCTGGTGGCGTTCGTCCCGCACCAGGCCAAC
CTGCGGATCATCGACGTGCTGGTGGACCGGCTCGGCGTGCCGGAGCACGTGGTCGTCTCG
CGCGACGCGGAGGACACCGGCAACACCTCGTCGGCGTCGGTGGCCCTGGCCCTGGACCGG
CTGGTGCGCTCCGGCGCGGTGCCCGGCGGCGGGCCCGCGCTGATGATCGGTTTCGGCGCC
GGGCTGAGCTACGCGGGCCAGGCTCTACTGCTTCCCGACCCGCCGTCCACTCCGGCTTGA
KS10..331
KS28..993

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004655 Beta-ketoacyl-acyl carrier protein synthase III (FabH) (Family)
 [12-328]  5.09999999999992e-100 TIGR00747
TIGR00747   FabH
IPR013747 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C-terminal (Domain)
 [241-329]  8.70000000000003e-26 PF08541
PF08541   ACP_syn_III_C
IPR013751 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III (Domain)
 [115-183]  3.60000000000001e-24 PF08545
PF08545   ACP_syn_III
IPR016038 Thiolase-like, subgroup (Domain)
 [12-168]  5.10000000000004e-56 G3DSA:3.40.47.10 [169-327]  5.49999999999995e-41 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [1-334]  2.19999900980707e-58 SSF53901
SSF53901   Thiolase-like
SignalP No significant hit
TMHMM No significant hit