close all open/close all

CDS information : R1128_00090


close this sectionLocation

Organism
StrainR1128
Entry nameR1128
Contig
Start / Stop / Direction10,903 / 11,412 / + [in whole cluster]
10,903 / 11,412 / + [in contig]
Location10903..11412 [in whole cluster]
10903..11412 [in contig]
TypeCDS
Length510 bp (169 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productcyclase/dehydratase
Product (GenBank)cyclase
Gene
Gene (GenBank)zhuI
EC number
Keyword
  • 1st ring
  • unreduced polyketide
Note
Note (GenBank)
Reference
ACC
PmId
[10931852] Cloning, nucleotide sequence, and heterologous expression of the biosynthetic gene cluster for R1128, a non-steroidal estrogen receptor antagonist. Insights into an unusual priming mechanism. (J Biol Chem. , 2000)
[21870821] Structural and biochemical characterization of ZhuI aromatase/cyclase from the R1128 polyketide pathway. (Biochemistry. , 2011)
Related Reference
ACC
P23154
PmId
[9630896] Engineered biosynthesis of novel polyketides: properties of the whiE aromatase/cyclase. (Nat Biotechnol. , 1996)
[22432862] Insight into the molecular basis of aromatic polyketide cyclization: crystal structure and in vitro characterization of WhiE-ORFVI. (Biochemistry. , 2012)
ACC
P16559
PmId
[1548230] Nucleotide sequence of the tcmII-tcmIV region of the tetracenomycin C biosynthetic gene cluster of Streptomyces glaucescens and evidence that the tcmN gene encodes a multifunctional cyclase-dehydratase-O-methyl transferase. (J Bacteriol. , 1992)
[8692863] Deciphering the mechanism for the assembly of aromatic polyketides by a bacterial polyketide synthase. (Proc Natl Acad Sci U S A. , 1996)
[9195917] Domain analysis of the molecular recognition features of aromatic polyketide synthase subunits. (J Biol Chem. , 1997)
[18388203] Crystal structure and functional analysis of tetracenomycin ARO/CYC: implications for cyclization specificity of aromatic polyketides. (Proc Natl Acad Sci U S A. , 2008)

close this sectionSequence

selected fasta
>cyclase/dehydratase [cyclase]
MRHVEHTVTVAAPADLVWEVLADVLGYADIFPPTEKVEILEEGQGYQVVRLHVDVAGEIN
TWTSRRDLDPARRVIAYRQLETAPIVGHMSGEWRAFTLDAERTQLVLTHDFVTRAAGDDG
LVAGKLTPDEAREMLEAVVERNSVADLNAVLGEAERRVRAAGGVGTVTA
selected fasta
>cyclase/dehydratase [cyclase]
ATGCGTCACGTCGAACACACCGTCACCGTAGCGGCCCCGGCCGACCTGGTCTGGGAGGTG
CTGGCCGATGTGCTCGGCTACGCCGACATCTTCCCGCCGACCGAGAAGGTCGAGATCCTC
GAGGAGGGTCAGGGCTACCAGGTCGTCCGCCTGCACGTGGACGTCGCCGGCGAGATCAAC
ACCTGGACCTCGCGCCGCGACCTGGACCCGGCCCGCCGCGTCATCGCCTACCGGCAGTTG
GAGACGGCCCCGATCGTCGGGCACATGAGCGGCGAGTGGCGCGCCTTCACGCTGGACGCC
GAGCGCACCCAACTGGTGCTCACCCACGACTTCGTGACGCGCGCGGCCGGCGACGACGGC
CTGGTGGCCGGCAAGCTCACCCCCGACGAGGCGCGCGAGATGCTGGAGGCGGTCGTCGAG
CGCAACAGCGTCGCCGACCTGAACGCGGTGCTCGGCGAGGCCGAGCGTCGGGTGCGCGCG
GCCGGCGGCGTCGGGACGGTGACCGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR019587 Polyketide cyclase/dehydrase (Family)
 [1-150]  2.6e-13 PF10604
PF10604   Polyketide_cyc2
IPR023393 START-like domain (Domain)
 [1-141]  1.7e-14 G3DSA:3.30.530.20
G3DSA:3.30.530.20   G3DSA:3.30.530.20
SignalP
 [1-22]  0.285 Signal
Eukaryota   
TMHMM No significant hit