close all open/close all

CDS information : R1128_00100


close this sectionLocation

Organism
StrainR1128
Entry nameR1128
Contig
Start / Stop / Direction11,409 / 12,179 / + [in whole cluster]
11,409 / 12,179 / + [in contig]
Location11409..12179 [in whole cluster]
11409..12179 [in contig]
TypeCDS
Length771 bp (256 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative cyclase
Product (GenBank)cyclase
Gene
Gene (GenBank)zhuJ
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[10931852] Cloning, nucleotide sequence, and heterologous expression of the biosynthetic gene cluster for R1128, a non-steroidal estrogen receptor antagonist. Insights into an unusual priming mechanism. (J Biol Chem. , 2000)
Related Reference
ACC
Q9RN54
NITE
Nogl_00250
PmId
[11683270] The entire nogalamycin biosynthetic gene cluster of Streptomyces nogalater: characterization of a 20-kb DNA region and generation of hybrid structures. (Mol Genet Genomics. , 2001)
[12715874] Studies on a second and third ring cyclization in anthracycline biosynthesis. (J Antibiot (Tokyo). , 2003)
ACC
O68500
NITE
Adria_00160
PmId
[9573189] The Streptomyces peucetius dpsY and dnrX genes govern early and late steps of daunorubicin and doxorubicin biosynthesis. (J Bacteriol. , 1998)
[10419974] The Streptomyces peucetius dpsC gene determines the choice of starter unit in biosynthesis of the daunorubicin polyketide. (J Bacteriol. , 1999)
ACC
Q9L4U2
NITE
Acla_00250
PmId
[12715874] Studies on a second and third ring cyclization in anthracycline biosynthesis. (J Antibiot (Tokyo). , 2003)

close this sectionSequence

selected fasta
>putative cyclase [cyclase]
MSGRKTFLDLSFATRDTPSEATPVVVDLLDHVTGATVLGLSPEDFPDGMAISNETVTLTT
HTGTHMDAPLHYGPLSGGVPAKSIDQVPLEWCYGPGVRLDVRHVPAGDGITVDHLNAALD
AAEHDLAPGDIVMLWTGADALWGTREYLSTFPGLTGKGTQFLVEAGVKVIGIDAWGLDRP
MAAMIEEYRRTGDKGALWPAHVYGRTREYLQLEKLNNLGALPGATGYDISCFPVAVAGTG
AGWTRVVAVFEQEEED
selected fasta
>putative cyclase [cyclase]
GTGAGCGGCCGCAAGACGTTCCTCGACCTGAGCTTCGCGACCCGGGACACCCCCAGCGAG
GCCACCCCGGTCGTCGTCGACCTGCTCGACCACGTGACCGGCGCGACGGTGCTCGGGCTG
AGCCCCGAGGACTTCCCCGACGGCATGGCCATCTCGAACGAGACGGTCACCCTCACCACG
CACACCGGCACGCACATGGACGCGCCGCTGCACTACGGCCCGCTCAGCGGCGGCGTGCCG
GCCAAGTCGATCGACCAGGTCCCGCTGGAGTGGTGCTACGGCCCGGGCGTGCGCCTGGAC
GTGCGGCACGTGCCGGCCGGCGACGGCATCACCGTCGACCACCTCAACGCCGCGCTCGAC
GCCGCCGAGCACGACCTGGCGCCCGGCGACATCGTCATGTTGTGGACCGGCGCGGACGCC
CTGTGGGGCACCCGCGAGTACCTGTCCACCTTCCCCGGACTGACCGGCAAGGGAACGCAG
TTCCTGGTCGAGGCGGGCGTGAAGGTGATCGGCATCGACGCGTGGGGCCTGGACCGGCCG
ATGGCCGCGATGATCGAGGAGTACCGGCGTACCGGCGACAAGGGCGCCTTGTGGCCGGCG
CACGTCTACGGGCGCACCCGCGAATACCTCCAGTTGGAGAAGCTCAACAACCTGGGCGCG
CTGCCCGGCGCCACCGGATACGACATCAGTTGCTTCCCGGTCGCCGTCGCGGGCACCGGT
GCGGGCTGGACCCGGGTGGTCGCCGTGTTCGAGCAGGAAGAGGAGGACTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007325 Putative cyclase (Family)
 [43-180]  2.19999999999997e-42 PF04199
PF04199   Cyclase
SignalP
 [1-35]  0.131 Signal
Eukaryota   
TMHMM No significant hit