close all open/close all

CDS information : R1128_00110


close this sectionLocation

Organism
StrainR1128
Entry nameR1128
Contig
Start / Stop / Direction12,183 / 13,757 / + [in whole cluster]
12,183 / 13,757 / + [in contig]
Location12183..13757 [in whole cluster]
12183..13757 [in contig]
TypeCDS
Length1,575 bp (524 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative oxidoreductase
Product (GenBank)oxygenase
Gene
Gene (GenBank)zhuK
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[10931852] Cloning, nucleotide sequence, and heterologous expression of the biosynthetic gene cluster for R1128, a non-steroidal estrogen receptor antagonist. Insights into an unusual priming mechanism. (J Biol Chem. , 2000)
Related Reference
ACC
Q5U913
NITE
Jado_00150
PmId
[15817470] Functional analyses of oxygenases in jadomycin biosynthesis and identification of JadH as a bifunctional oxygenase/dehydrase. (J Biol Chem. , 2005)
[15776503] The oxidative ring cleavage in jadomycin biosynthesis: a multistep oxygenation cascade in a biosynthetic black box. (Chembiochem. , 2005)
[17346045] Multi-oxygenase complexes of the gilvocarcin and jadomycin biosyntheses. (J Am Chem Soc. , 2007)
[20422670] Characterization of JadH as an FAD- and NAD(P)H-dependent bifunctional hydroxylase/dehydrase in jadomycin biosynthesis. (Chembiochem. , 2010)
[22633416] Tailoring enzymes involved in the biosynthesis of angucyclines contain latent context-dependent catalytic activities. (Chem Biol. , 2012)

close this sectionSequence

selected fasta
>putative oxidoreductase [oxygenase]
MDADVIIAGAGPTGLMLAAELRLAGADVLILELLPEPTGQSRALGINPRAVELLDARGLM
GRFADQHTITNSHYGALHRPLDFSRLDTAHGVMMVPQRRTEKELGEWARGLGARILHGHT
VVGLTQYADRVEVEADTSEGTRTFTARYVVGADGSRSSVRQLSGIGYPGVPSTVDALMCD
VSGLDLAFKFFERNDRGLWAVFPVGDGVFRVVVYAFDRPPVRGADAPSFEEVNDAARTIA
GIDLTGGTPHWLSRHGNTTRIADRFRAERVFLAGDAAHVVPPAGGQLLTTGLHDATNLGW
KLGAAVAGWGSDDLLDSYQDERYPVAERIILNARVQNLLMSGGLDIAALRELFTELVEFD
EVNFYLSGQLSAVSVRYDVGGDHPMLGLGLPHRTLETDAGEVTTTELLRSARGLLLEVGD
APGFADLVAPYADRVDVRVARVPAGSPGFDGVTAVLVRPDTHVAWVAETPAGADAADADR
DALGTALRRWFGAPADTNSGAESGTESGTQTAAPVGAGTAGGTP
selected fasta
>putative oxidoreductase [oxygenase]
ATGGACGCCGACGTCATCATCGCCGGTGCCGGCCCCACCGGACTCATGCTGGCCGCCGAG
CTGCGGCTGGCCGGCGCCGACGTGCTGATCCTGGAGCTGCTGCCGGAGCCCACCGGCCAG
TCGCGCGCGCTCGGCATCAACCCGCGCGCCGTCGAACTGCTGGACGCGCGCGGCCTGATG
GGCCGGTTCGCCGACCAGCACACCATCACCAACTCGCACTACGGCGCGCTGCACCGCCCG
CTGGACTTCAGCCGGCTCGACACCGCGCACGGCGTCATGATGGTGCCGCAGCGCCGCACC
GAGAAGGAACTGGGCGAGTGGGCCCGGGGGTTGGGCGCACGAATACTGCACGGGCACACC
GTGGTCGGACTGACCCAGTACGCCGACCGGGTCGAGGTCGAGGCCGACACGTCCGAGGGC
ACACGCACCTTCACCGCGCGGTACGTGGTCGGCGCCGACGGCAGCCGCAGCAGTGTGCGG
CAGTTGTCCGGCATCGGCTACCCGGGCGTGCCGTCGACCGTCGACGCGCTCATGTGCGAC
GTGTCGGGCCTGGACCTGGCCTTCAAGTTCTTCGAGCGCAACGACCGTGGCTTGTGGGCG
GTGTTCCCGGTCGGCGACGGCGTCTTCCGGGTCGTGGTCTACGCGTTCGACCGCCCGCCG
GTGCGCGGCGCGGACGCGCCCTCCTTCGAGGAGGTCAACGACGCGGCCCGCACCATTGCG
GGGATCGACCTGACCGGCGGCACGCCGCACTGGCTGAGCCGGCACGGCAACACCACCCGG
ATCGCCGACCGGTTCCGCGCCGAGCGGGTGTTCCTGGCCGGCGACGCGGCGCACGTGGTC
CCGCCGGCGGGCGGCCAGTTGCTGACCACCGGGCTGCACGACGCGACCAACCTGGGCTGG
AAGCTCGGCGCGGCGGTCGCCGGCTGGGGGTCCGACGACCTGCTCGACAGCTACCAGGAC
GAGCGGTACCCGGTCGCCGAGCGGATCATCCTCAACGCGCGCGTGCAGAACCTGCTCATG
TCGGGCGGCCTGGACATCGCCGCGCTGCGCGAACTGTTCACCGAGCTGGTCGAGTTCGAC
GAGGTGAACTTCTACCTGTCGGGTCAGCTCAGCGCGGTGTCGGTGCGCTACGACGTCGGC
GGCGACCACCCGATGCTGGGCCTGGGGCTGCCGCACCGCACGCTGGAGACCGACGCGGGC
GAGGTGACCACCACCGAGCTGCTGCGGTCGGCGCGCGGGCTGCTTCTGGAGGTCGGGGAC
GCGCCTGGCTTCGCGGACCTGGTCGCGCCGTACGCGGACCGGGTGGACGTCCGGGTCGCG
CGCGTCCCGGCCGGCTCCCCCGGGTTCGACGGGGTCACCGCCGTGCTGGTCCGCCCGGAC
ACGCACGTCGCGTGGGTCGCCGAGACCCCCGCGGGCGCCGACGCGGCGGACGCGGACCGC
GACGCGCTCGGCACCGCGCTGCGCCGCTGGTTCGGCGCGCCGGCCGACACGAACTCCGGC
GCGGAATCCGGTACGGAGTCCGGCACGCAGACCGCCGCGCCCGTCGGCGCCGGGACCGCC
GGGGGCACGCCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002938 Monooxygenase, FAD-binding (Domain)
 [3-331]  2.79999999999994e-69 PF01494
PF01494   FAD_binding_3
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [4-26]  3.10001307370206e-39 PR00420 [145-160]  3.10001307370206e-39 PR00420 [267-282]  3.10001307370206e-39 PR00420 [282-298]  3.10001307370206e-39 PR00420 [300-318]  3.10001307370206e-39 PR00420 [318-334]  3.10001307370206e-39 PR00420
PR00420   RNGMNOXGNASE
SignalP
 [1-26]  0.386 Signal
Eukaryota   
TMHMM No significant hit