close all open/close all

CDS information : R1128_00120


close this sectionLocation

Organism
StrainR1128
Entry nameR1128
Contig
Start / Stop / Direction13,754 / 15,277 / + [in whole cluster]
13,754 / 15,277 / + [in contig]
Location13754..15277 [in whole cluster]
13754..15277 [in contig]
TypeCDS
Length1,524 bp (507 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative amidase
Product (GenBank)enantiomer selective amidase
Gene
Gene (GenBank)zhuL
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[10931852] Cloning, nucleotide sequence, and heterologous expression of the biosynthetic gene cluster for R1128, a non-steroidal estrogen receptor antagonist. Insights into an unusual priming mechanism. (J Biol Chem. , 2000)
Related Reference
ACC
Q53116
PmId
[1938876] Purification, cloning, and primary structure of a new enantiomer-selective amidase from a Rhodococcus strain: structural evidence for a conserved genetic coupling with nitrile hydratase. (J Bacteriol. , 1991)

close this sectionSequence

selected fasta
>putative amidase [enantiomer selective amidase]
MTLDDGAVLAPAAVLTAALRRREISSRELLDLYLARVEAVNPALNAVVTLDVERARREAA
EADRATAAGARTGPLHGLPMTVKDTLETEGLRTTAGAAELAEHVPARDADSVALLRRAGA
VVFGKTNTATYASDAQTYNPVFGTTNNPWDTSRAPGGSSGGAAAALAAGLTSLELGGELS
GSARYPAHCCGVFALRPSFGIVPMRGHIPRQPGSLKTNDMVTLAPLARSAADLDLLLDVL
ARPAADKAPAWRLDLPAPRAESLGGLRVGLWLDDPLCPVDAEVGDVLAAAVDALKGTGVA
RLADVTPVDRATHDRLYERLLQGAVSLGLPAPVYAANQAAAAALAPDDDSPRASFLRAAT
LSHRDWLAADEEREHQRARWAEVFDEFDVVLSPVAPVVATPHDQRPDLSARRITVNGAQR
PYWDIIRWTSPATAAGLPAASVPVGVARSGLPVGLQVVGPHLHDRTVTWFARRVSELLGG
FQAPPLRAAGNDGASPGSSRTEGADRA
selected fasta
>putative amidase [enantiomer selective amidase]
ATGACCCTCGACGACGGCGCGGTCCTCGCGCCCGCCGCCGTCCTGACGGCGGCGCTGCGC
CGCCGGGAGATCTCCAGCCGCGAACTGCTCGACCTGTACCTGGCCCGCGTCGAGGCGGTG
AACCCGGCGCTGAACGCCGTGGTCACCCTCGACGTGGAACGGGCCCGCCGCGAGGCGGCC
GAGGCGGACCGCGCGACGGCGGCCGGCGCCCGTACCGGGCCGCTGCACGGGCTGCCGATG
ACGGTCAAGGACACCCTGGAGACCGAGGGTCTGCGCACCACGGCCGGCGCCGCGGAACTG
GCCGAGCACGTGCCGGCCCGCGACGCGGACTCGGTGGCGCTGCTGCGCCGCGCGGGCGCG
GTGGTGTTCGGCAAGACCAACACCGCCACCTACGCCTCCGACGCGCAGACCTACAACCCG
GTGTTCGGCACCACCAACAACCCGTGGGACACCTCCCGCGCGCCGGGCGGGTCCTCGGGC
GGCGCGGCGGCCGCGCTCGCCGCCGGGCTGACGTCGCTGGAACTGGGCGGCGAGCTGTCC
GGTTCGGCGCGCTACCCGGCGCACTGCTGCGGCGTGTTCGCGCTGCGGCCGTCCTTCGGG
ATCGTGCCGATGCGCGGCCACATCCCGCGCCAACCGGGGTCGCTGAAGACCAACGACATG
GTGACGCTGGCGCCGCTCGCCCGCAGCGCGGCCGACCTCGACCTGCTGCTCGACGTGCTG
GCCCGGCCGGCCGCCGACAAGGCGCCCGCGTGGCGCCTGGACCTGCCCGCGCCGCGCGCC
GAATCGCTGGGCGGGCTGCGCGTGGGGCTGTGGCTGGACGACCCGCTGTGCCCGGTCGAC
GCCGAGGTCGGCGACGTGCTGGCGGCGGCGGTCGACGCCCTCAAGGGCACCGGCGTCGCA
CGGCTGGCGGACGTCACGCCGGTCGACCGCGCGACGCACGACCGGCTCTACGAGCGGCTG
TTGCAGGGCGCGGTCAGTCTCGGACTGCCCGCCCCGGTGTACGCGGCCAACCAGGCCGCG
GCCGCCGCGCTCGCCCCCGACGACGACTCGCCGCGCGCGTCGTTCCTGCGCGCCGCGACG
CTGTCGCACCGCGACTGGCTGGCGGCCGACGAGGAGCGCGAGCACCAGCGGGCCCGTTGG
GCCGAGGTGTTCGACGAGTTCGACGTCGTCCTGTCGCCCGTCGCGCCGGTCGTCGCGACG
CCGCACGACCAGCGTCCCGACCTGTCCGCGCGGCGGATCACCGTCAACGGCGCCCAACGG
CCCTACTGGGACATCATCCGCTGGACCAGCCCGGCCACCGCGGCCGGCCTGCCGGCCGCG
TCCGTCCCGGTGGGGGTGGCCCGTTCGGGCCTGCCGGTCGGGCTCCAGGTGGTCGGCCCG
CACCTGCACGACCGCACCGTCACGTGGTTCGCCCGGCGTGTCTCGGAGCTGCTCGGCGGC
TTCCAGGCCCCGCCCCTGCGCGCCGCCGGGAACGACGGGGCGTCCCCCGGATCATCACGA
ACGGAAGGAGCGGACCGTGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000120 Amidase (Family)
 [28-467]  5.09999999999993e-103 PF01425
PF01425   Amidase
IPR023631 Amidase signature domain (Domain)
 [3-487]  5.60004908290974e-109 SSF75304
SSF75304   Amidase_sig_enz
 [10-484]  3.30000000000002e-118 G3DSA:3.90.1300.10
G3DSA:3.90.1300.10   Amidase_sig_enz
SignalP No significant hit
TMHMM No significant hit