close all open/close all
R1128_00130 R1128_00130   last last

CDS information : R1128_00140


close this sectionLocation

Organism
StrainR1128
Entry nameR1128
Contig
Start / Stop / Direction16,861 / 17,109 / + [in whole cluster]
16,861 / 17,109 / + [in contig]
Location16861..17109 [in whole cluster]
16861..17109 [in contig]
TypeCDS
Length249 bp (82 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase acyl carrier protein subunit
Product (GenBank)acyl carrier protein
Gene
Gene (GenBank)zhuN
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[10931852] Cloning, nucleotide sequence, and heterologous expression of the biosynthetic gene cluster for R1128, a non-steroidal estrogen receptor antagonist. Insights into an unusual priming mechanism. (J Biol Chem. , 2000)
[11732905] In vitro reconstitution and analysis of the chain initiating enzymes of the R1128 polyketide synthase. (Biochemistry. , 2001)
[12767243] Ketosynthases in the initiation and elongation modules of aromatic polyketide synthases have orthogonal acyl carrier protein specificity. (Biochemistry. , 2003)

close this sectionPKS/NRPS Module

ACP2..75

close this sectionSequence

selected fasta
>polyketide synthase acyl carrier protein subunit [acyl carrier protein]
MTIDDLRRILTECAGEDESVDLGGDILDTPFTELGYDSLALMETAARIEQEFGVAIPDDE
FAELATPRAVLAAVSTAVSAAA
selected fasta
>polyketide synthase acyl carrier protein subunit [acyl carrier protein]
ATGACGATCGACGACCTGCGCAGGATCCTGACCGAGTGCGCCGGCGAGGACGAGTCCGTC
GACCTGGGCGGCGACATCCTGGACACGCCGTTCACCGAGCTGGGCTACGACTCGCTCGCG
CTGATGGAGACCGCCGCCCGCATCGAGCAGGAGTTCGGTGTCGCGATACCGGACGACGAG
TTCGCCGAACTGGCGACGCCGCGTGCGGTGTTGGCCGCGGTCTCCACGGCGGTCTCGGCC
GCGGCCTGA
ACP2..75
ACP4..225

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006162 Phosphopantetheine attachment site (PTM)
 [33-48]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1-81]  7.30000590915208e-16 SSF47336
SSF47336   ACP_like
 [8-74]  3.2e-14 PF00550
PF00550   PP-binding
 [2-77]  1.1e-18 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [2-75]  PS50075
PS50075   ACP_DOMAIN
SignalP No significant hit
TMHMM No significant hit
R1128_00130 R1128_00130   last last