close all open/close all
first first   Rapam_00020 Rapam_00020

CDS information : Rapam_00010


close this sectionLocation

Organism
StrainNRRL 5491
Entry nameRapamycin
Contig
Start / Stop / Direction871 / 1 / - [in whole cluster]
871 / 1 / - [in contig]
Locationcomplement(1..871) [in whole cluster]
complement(1..871) [in contig]
TypeCDS
Length871 bp (289 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative transporter(fragment)
Product (GenBank)monosaccharide transporter
Gene
Gene (GenBank)orfZZ
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[7644502] The biosynthetic gene cluster for the polyketide immunosuppressant rapamycin. (Proc Natl Acad Sci U S A. , 1995)
[8635730] Organisation of the biosynthetic gene cluster for rapamycin in Streptomyces hygroscopicus: analysis of genes flanking the polyketide synthase. (Gene. , 1996)
Related Reference
ACC
P15686
PmId
[2599110] The hexose carrier from Chlorella. cDNA cloning of a eucaryotic H+-cotransporter. (FEBS Lett. , 1989)

close this sectionSequence

selected fasta
>putative transporter(fragment) [monosaccharide transporter]
MAPRPSVRSVADVVALIDGLGKITGRAQIIWFLVFGGLFLDAYSNAALSAGLGPMTTQME
LTSTQVSILTATAPALAILFNPLGGWLATRIGRVPPLLIAKLFAIAGALLAAFAGDFTVV
WLGRVLVGVAYGMDFAVAMALLAEYTPAKLGGRLNLWQAVWYIATTSNLVLALVFFNLDV
GADIWRWSVGSAAVVAVALLLGQWLMLKESPTWLAGKGRLGEAITNLDKIYGIKAVAGTP
DEMTRTPAEAPVIGLRQAGRLFRGEYLPRTILSSVISLGQSMQYFAVGWY-
selected fasta
>putative transporter(fragment) [monosaccharide transporter]
ATGGCACCACGTCCGAGCGTCAGAAGCGTCGCCGACGTCGTTGCGCTCATCGATGGGCTG
GGAAAGATCACCGGCCGGGCGCAGATCATCTGGTTCCTCGTGTTCGGCGGGCTGTTCCTC
GACGCCTACTCGAACGCCGCGCTGAGCGCCGGACTTGGGCCCATGACGACCCAGATGGAG
CTCACCAGCACCCAGGTCTCGATCCTCACGGCCACCGCTCCGGCCCTGGCGATCCTCTTC
AACCCCCTCGGCGGCTGGCTCGCCACCCGCATCGGCCGGGTCCCCCCGCTGCTCATCGCC
AAGCTGTTCGCGATCGCGGGTGCCCTGCTCGCCGCCTTCGCAGGTGACTTCACCGTCGTC
TGGCTCGGCCGGGTGCTGGTGGGTGTCGCCTACGGGATGGACTTCGCGGTCGCCATGGCG
CTGCTCGCCGAGTACACCCCCGCGAAGCTGGGCGGTCGGCTCAACCTGTGGCAAGCCGTC
TGGTACATCGCCACCACCAGCAACCTCGTCCTCGCCCTGGTCTTCTTCAACCTGGACGTC
GGCGCGGACATCTGGCGCTGGTCGGTCGGCTCGGCCGCGGTCGTCGCCGTCGCGCTCCTC
CTGGGCCAGTGGCTGATGCTCAAGGAGAGCCCCACCTGGCTGGCCGGCAAGGGCCGCCTG
GGCGAGGCGATCACCAACCTGGACAAGATCTACGGGATCAAGGCCGTCGCCGGTACGCCC
GACGAGATGACCCGCACCCCGGCTGAGGCGCCGGTCATCGGGCTCCGGCAGGCCGGACGG
CTGTTCAGGGGCGAGTACCTGCCGCGTACGATCCTCTCCTCGGTGATCTCGCTCGGCCAG
TCGATGCAGTACTTCGCCGTCGGCTGGTACC

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005828 General substrate transporter (Family)
 [59-281]  5.8e-22 PF00083
PF00083   Sugar_tr
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-290]  5.4e-34 SSF103473
SSF103473   MFS general substrate transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [30-291]  21.735 PS50850
PS50850   MFS
SignalP No significant hit
TMHMM
 [29-51]  Transmembrane (i-o) [66-88]  Transmembrane (o-i) [101-123]  Transmembrane (i-o) [156-178]  Transmembrane (o-i) [185-207]  Transmembrane (i-o)
Transmembrane 5   
first first   Rapam_00020 Rapam_00020