close all open/close all

CDS information : Rapam_00030


close this sectionLocation

Organism
StrainNRRL 5491
Entry nameRapamycin
Contig
Start / Stop / Direction2,422 / 3,036 / + [in whole cluster]
2,422 / 3,036 / + [in contig]
Location2422..3036 [in whole cluster]
2422..3036 [in contig]
TypeCDS
Length615 bp (204 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative TetR family transcriptional regulator
Product (GenBank)regulator of antibiotic transport complexes
GeneorfY
rapY
Gene (GenBank)orfY
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[7644502] The biosynthetic gene cluster for the polyketide immunosuppressant rapamycin. (Proc Natl Acad Sci U S A. , 1995)
[8635730] Organisation of the biosynthetic gene cluster for rapamycin in Streptomyces hygroscopicus: analysis of genes flanking the polyketide synthase. (Gene. , 1996)
Related Reference
ACC
P96676
PmId
[15944459] The TetR family of transcriptional repressors. (Microbiol Mol Biol Rev. , 2005)

close this sectionSequence

selected fasta
>putative TetR family transcriptional regulator [regulator of antibiotic transport complexes]
MTAQQKKGRPATGGAALRQRVTEAITEAAFAELADAGYARMSMESVARRAGVGKAALYRR
WPSKQAMVTELIRGKVTDTLPPTPATGALRTDLRELLTTFRGQLANPLLARIAAGLLAEA
SHDDALAEGLYTGVTAPRRAAAHAILRGAIDRGELPPGLDLDLGTDLLIAPLAFRVLVIQ
GRSDDEYLETLTNAIEAALRAAVR
selected fasta
>putative TetR family transcriptional regulator [regulator of antibiotic transport complexes]
ATGACAGCGCAGCAGAAGAAGGGCCGGCCGGCGACCGGCGGGGCGGCCCTGCGACAGCGG
GTAACCGAGGCGATCACCGAGGCGGCCTTCGCCGAACTCGCCGACGCCGGGTACGCGCGG
ATGTCGATGGAGTCGGTGGCCCGGCGGGCCGGCGTGGGCAAGGCCGCGCTCTACCGGCGC
TGGCCCTCGAAGCAGGCGATGGTCACCGAACTGATCCGCGGCAAGGTCACCGACACGCTC
CCGCCCACGCCCGCCACCGGCGCCCTGCGCACCGACCTGCGCGAACTGCTCACCACCTTC
CGCGGTCAACTGGCCAATCCGCTGCTTGCCCGGATCGCGGCCGGGCTGCTCGCCGAGGCC
AGTCACGACGACGCTCTGGCGGAGGGGCTCTACACCGGAGTGACCGCACCGCGGCGGGCG
GCGGCGCACGCGATACTGCGGGGCGCGATCGACCGCGGCGAACTCCCTCCCGGGCTGGAT
CTGGACCTCGGCACCGACCTGCTGATCGCCCCGCTCGCATTCCGCGTACTGGTCATACAG
GGCCGAAGCGACGATGAGTATCTGGAGACGCTGACCAACGCGATCGAGGCGGCGTTGCGA
GCGGCCGTCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [19-79]  PS50977
PS50977   HTH_TETR_2
 [25-38]  5.90000104995095e-06 PR00455 [46-69]  5.90000104995095e-06 PR00455
PR00455   HTHTETR
 [25-71]  2.2e-15 PF00440
PF00440   TetR_N
IPR009057 Homeodomain-like (Domain)
 [19-63]  3.39999999999999e-18 G3DSA:1.10.10.60
G3DSA:1.10.10.60   Homeodomain-rel
 [9-97]  1.09999909120787e-12 SSF46689
SSF46689   Homeodomain_like
IPR011075 Tetracycline transcriptional regulator, TetR-related, C-terminal (Domain)
 [84-202]  3.69999438558106e-24 SSF48498
SSF48498   TetR_like_C
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [64-201]  2.7e-32 G3DSA:1.10.357.10
G3DSA:1.10.357.10   TetR_C
IPR023772 DNA-binding HTH domain, TetR-type, conserved site (Conserved_site)
 [37-68]  PS01081
PS01081   HTH_TETR_1
SignalP No significant hit
TMHMM No significant hit