close all open/close all

CDS information : Rapam_00040


close this sectionLocation

Organism
StrainNRRL 5491
Entry nameRapamycin
Contig
Start / Stop / Direction3,763 / 3,056 / - [in whole cluster]
3,763 / 3,056 / - [in contig]
Locationcomplement(3056..3763) [in whole cluster]
complement(3056..3763) [in contig]
TypeCDS
Length708 bp (235 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative ABC transporter ATP-binding protein
Product (GenBank)ABC-transporter
Gene
Gene (GenBank)orfX
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[7644502] The biosynthetic gene cluster for the polyketide immunosuppressant rapamycin. (Proc Natl Acad Sci U S A. , 1995)
[8635730] Organisation of the biosynthetic gene cluster for rapamycin in Streptomyces hygroscopicus: analysis of genes flanking the polyketide synthase. (Gene. , 1996)
Related Reference
ACC
Q58206
PmId
[11402022] The crystal structure of the MJ0796 ATP-binding cassette. Implications for the structural consequences of ATP hydrolysis in the active site of an ABC transporter. (J Biol Chem. , 2001)
[12150914] ATP binding to the motor domain from an ABC transporter drives formation of a nucleotide sandwich dimer. (Mol Cell. , 2002)

close this sectionSequence

selected fasta
>putative ABC transporter ATP-binding protein [ABC-transporter]
MTSATAAPPVLRLAGVSHTYSGQRRRTAVLKDIDYAFERGTFYTILGPSGSGKTTLLSLA
SGLDTPTKGTITFEGQDLTELGLGRYRNQHAATIFQQYNLLTYLTALQNVTCAMEITGTK
PTTGSRKARALHLLEKIGLDKAMATRNVLQLSGGQQQRVAIARALACDVDILFADEPTGN
LDEDTAAGIIGTFRELAHEQDKCVVVVSHSQQLAAQSDRVLTLRKGKLTEQVNAR
selected fasta
>putative ABC transporter ATP-binding protein [ABC-transporter]
ATGACCAGCGCCACCGCCGCCCCGCCCGTTCTGCGTCTCGCGGGCGTCAGCCACACCTAC
TCGGGCCAGCGCCGCAGGACCGCGGTCCTCAAGGACATCGACTACGCCTTCGAACGCGGC
ACCTTTTACACCATCCTGGGCCCTTCCGGCAGCGGCAAGACCACCCTGCTCTCCCTCGCC
AGCGGTCTCGACACCCCCACCAAGGGCACCATCACCTTCGAGGGCCAGGACCTCACCGAA
CTGGGCCTCGGCCGGTACCGCAACCAGCACGCCGCCACGATCTTCCAGCAGTACAACCTC
CTCACCTACCTGACCGCCCTCCAGAACGTCACCTGCGCCATGGAGATCACCGGCACCAAA
CCCACGACCGGCAGTCGCAAGGCCCGGGCTCTGCACCTGCTGGAGAAGATCGGCCTCGAC
AAGGCGATGGCCACCCGCAACGTCCTCCAGCTCTCCGGAGGCCAGCAGCAGCGCGTCGCC
ATCGCCCGCGCCCTCGCCTGCGACGTCGACATCCTCTTCGCCGACGAACCCACCGGAAAC
CTCGACGAGGACACCGCCGCGGGCATCATCGGCACCTTCCGCGAACTCGCTCACGAGCAG
GACAAATGCGTGGTCGTCGTGTCCCACTCCCAGCAACTGGCCGCCCAGTCCGACCGTGTC
CTCACCCTGCGCAAGGGAAAACTCACAGAACAGGTCAACGCCCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003439 ABC transporter-like (Domain)
 [54-178]  1.1e-21 PF00005
PF00005   ABC_tran
 [11-234]  PS50893
PS50893   ABC_TRANSPORTER_2
IPR003593 AAA+ ATPase domain (Domain)
 [39-227]  2.59999946718995e-14 SM00382
SM00382   AAA
IPR017871 ABC transporter, conserved site (Conserved_site)
 [151-165]  PS00211
PS00211   ABC_TRANSPORTER_1
SignalP No significant hit
TMHMM No significant hit