close all open/close all

CDS information : Rapam_00050


close this sectionLocation

Organism
StrainNRRL 5491
Entry nameRapamycin
Contig
Start / Stop / Direction5,149 / 3,770 / - [in whole cluster]
5,149 / 3,770 / - [in contig]
Locationcomplement(3770..5149) [in whole cluster]
complement(3770..5149) [in contig]
TypeCDS
Length1,380 bp (459 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)
Gene
Gene (GenBank)orfW
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[7644502] The biosynthetic gene cluster for the polyketide immunosuppressant rapamycin. (Proc Natl Acad Sci U S A. , 1995)
[8635730] Organisation of the biosynthetic gene cluster for rapamycin in Streptomyces hygroscopicus: analysis of genes flanking the polyketide synthase. (Gene. , 1996)

close this sectionSequence

selected fasta
>hypothetical protein
MNFVKRAGLSLWSRKGRTLITLATFLVISVMVLAGVLINDATAQAEQDARRSVGAEVNLE
ADLGQLGGGSELRAPRIDAATVDKVGALPQVRKYTYSIWDRVLLKGGPQLADGGPKEPMG
PGGTVGMGVLDTSLLPDFRSGKFTLLSGEHLTAADKGKKRLLIEERLAKENKLGVGDTIT
LTGNDEKTTADFTVAGVYRDPSPATEPDSEYGISPANMLYGTVGGLSALSSERNGPLQAG
KATFLLQDADTQGAFKDEAKKVAGPALDGFKLDANDKAIRQMTGPLKSISTTATLAMWLM
GLAGAAVLTLLVNLAVKQRHKEYGVLLAMGEKKRKLIAQQALEILVVGALAIGLSSLFAP
RLTQSAGQALLGREATSAQHKIDSWQGPPSGSTGLGEGIDPNDKPVEDADPIDKITVRLD
PADLATLGAIGLGIGLLATAVPAGAVLRLSPRTILTKGK
selected fasta
>hypothetical protein
ATGAACTTCGTCAAACGCGCGGGACTCAGCCTGTGGTCCCGCAAGGGCCGCACCCTGATC
ACCCTCGCCACCTTCCTCGTCATCTCCGTGATGGTGCTGGCCGGTGTCCTGATCAACGAC
GCCACGGCCCAGGCCGAGCAAGACGCCAGGCGTTCCGTCGGCGCCGAGGTCAACCTCGAG
GCGGATTTGGGCCAGTTGGGCGGCGGGAGCGAGCTGAGGGCTCCGCGCATCGACGCCGCG
ACCGTCGACAAGGTCGGGGCTCTGCCCCAGGTGCGGAAGTACACCTACTCGATCTGGGAC
CGCGTCCTCCTCAAGGGCGGCCCCCAACTGGCCGACGGTGGGCCGAAGGAGCCCATGGGC
CCCGGCGGCACCGTGGGCATGGGCGTGCTCGACACCTCGCTGCTGCCCGACTTCCGCAGC
GGCAAGTTCACGCTGCTGTCCGGTGAGCACCTCACCGCCGCCGACAAGGGCAAGAAGCGA
CTCCTGATCGAGGAACGGCTCGCCAAGGAGAACAAGCTCGGTGTCGGCGACACGATCACC
CTGACCGGCAACGACGAGAAGACCACGGCCGACTTCACCGTGGCCGGCGTCTACCGCGAC
CCGAGCCCTGCCACCGAACCGGACAGCGAGTACGGCATCAGTCCGGCCAACATGCTGTAC
GGCACGGTGGGCGGCCTCTCCGCGCTCAGCTCCGAGCGGAACGGGCCGCTCCAGGCAGGT
AAGGCGACCTTCCTCCTCCAGGACGCCGACACGCAGGGTGCGTTCAAGGACGAGGCCAAA
AAGGTCGCGGGCCCGGCGCTCGACGGTTTCAAGCTGGACGCCAACGACAAGGCCATCCGG
CAGATGACCGGCCCGCTCAAGTCCATCAGCACTACCGCCACCCTGGCCATGTGGCTGATG
GGGCTCGCCGGTGCGGCCGTCCTGACGCTGCTGGTCAACCTCGCCGTCAAGCAGCGCCAC
AAGGAGTACGGCGTCCTGCTGGCCATGGGCGAGAAGAAACGCAAGCTCATCGCCCAACAG
GCCCTGGAGATCCTCGTCGTCGGCGCCCTCGCCATCGGCCTGAGCTCCCTGTTCGCCCCG
CGGCTGACCCAGAGCGCCGGGCAGGCCCTGCTCGGCAGGGAAGCCACCAGCGCCCAGCAC
AAGATCGACTCCTGGCAGGGCCCGCCGTCCGGCAGTACCGGCCTCGGCGAGGGCATCGAC
CCGAACGACAAGCCCGTCGAGGACGCCGACCCCATCGACAAGATCACCGTACGACTCGAT
CCGGCGGACCTCGCCACCCTCGGCGCCATCGGCCTCGGCATCGGCCTGCTCGCCACCGCC
GTCCCGGCCGGTGCCGTGCTGCGGCTGAGCCCCCGCACCATCCTCACGAAGGGCAAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003838 Permease FtsX-like (Domain)
 [295-451]  4.40000000000001e-32 PF02687
PF02687   FtsX
IPR025857 MacB-like periplasmic core domain (Domain)
 [10-261]  4.10000000000001e-20 PF12704
PF12704   MacB_PCD
SignalP
 [1-45]  1 Signal
Bacteria, Gram-positive   
 [1-34]  0.999 Signal
Bacteria, Gram-negative   
 [1-34]  0.615 Signal
Eukaryota   
TMHMM
 [19-38]  Transmembrane (i-o) [294-316]  Transmembrane (o-i) [336-358]  Transmembrane (i-o) [425-447]  Transmembrane (o-i)
Transmembrane 4