close all open/close all

CDS information : Rapam_00070


close this sectionLocation

Organism
StrainNRRL 5491
Entry nameRapamycin
Contig
Start / Stop / Direction6,703 / 7,365 / + [in whole cluster]
6,703 / 7,365 / + [in contig]
Location6703..7365 [in whole cluster]
6703..7365 [in contig]
TypeCDS
Length663 bp (220 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative two-component system response regulator
Product (GenBank)response regulator
GeneorfR
rapR
Gene (GenBank)orfR
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[7644502] The biosynthetic gene cluster for the polyketide immunosuppressant rapamycin. (Proc Natl Acad Sci U S A. , 1995)
[8635730] Organisation of the biosynthetic gene cluster for rapamycin in Streptomyces hygroscopicus: analysis of genes flanking the polyketide synthase. (Gene. , 1996)
Related Reference
ACC
P0A4I2
PmId
[8885276] The cutRS signal transduction system of Streptomyces lividans represses the biosynthesis of the polyketide antibiotic actinorhodin. (Mol Microbiol. , 1996)

close this sectionSequence

selected fasta
>putative two-component system response regulator [response regulator]
MRVLVAEDHRVLARTIATGLRRQAMAVDVAAAADEAERMCLLTAYDVLILDRDLPVLSGD
EVCRRLRELQDPPRILMLTAAGELTDKIYGLTTLGADDYLAKPFDFSELVARVRTLSRRA
PKQPPTVLRFASITLDETRREVSVDGRPLELTPKELAVLHLLLVAGGAPVSHDELVRTVW
DEHLDPRTSAVRATVSRLRGKLGDPGLILADKGEGYRLCD
selected fasta
>putative two-component system response regulator [response regulator]
ATGAGAGTTCTGGTAGCCGAGGACCACCGTGTTCTCGCCCGCACCATCGCCACCGGCCTG
CGCCGCCAGGCGATGGCCGTCGACGTGGCGGCCGCCGCCGACGAGGCCGAGCGGATGTGC
CTGCTCACCGCCTACGACGTGCTGATCCTCGACCGGGATCTGCCGGTCCTGAGCGGCGAC
GAGGTGTGCCGACGGCTGCGCGAACTCCAGGACCCTCCACGGATCCTGATGCTGACCGCG
GCCGGCGAGCTGACGGACAAGATCTACGGCCTCACGACACTCGGCGCCGACGACTACCTG
GCGAAACCCTTCGATTTCAGCGAACTGGTCGCCCGGGTACGGACGTTGAGCCGTCGCGCA
CCGAAGCAGCCCCCTACCGTGCTGCGCTTCGCGAGCATCACCCTGGACGAGACGCGGCGC
GAGGTGTCCGTGGACGGCCGCCCGCTGGAGCTGACCCCGAAGGAGCTCGCGGTCCTGCAC
CTGCTGCTTGTGGCCGGGGGCGCGCCGGTGTCGCACGACGAACTCGTCCGCACCGTCTGG
GACGAGCACCTCGACCCGCGCACCAGCGCGGTCCGCGCCACCGTCAGCCGGCTGCGCGGC
AAACTCGGCGACCCCGGCCTCATTCTCGCCGACAAGGGGGAGGGTTACCGGCTGTGCGAC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001789 Signal transduction response regulator, receiver domain (Domain)
 [3-114]  1.1e-20 PF00072
PF00072   Response_reg
 [2-117]  PS50110
PS50110   RESPONSE_REGULATORY
 [1-113]  3.29999077503323e-33 SM00448
SM00448   REC
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [146-218]  8.20000000000001e-16 PF00486
PF00486   Trans_reg_C
 [146-218]  1.70000295590054e-20 SM00862
SM00862   Trans_reg_C
IPR011006 CheY-like superfamily (Domain)
 [1-188]  7.30000590915208e-31 SSF52172
SSF52172   CheY_like
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [123-218]  1e-23 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP
 [1-26]  0.231 Signal
Eukaryota   
 [1-26]  0.151 Signal
Bacteria, Gram-negative   
TMHMM No significant hit