close all open/close all

CDS information : Rapam_00080


close this sectionLocation

Organism
StrainNRRL 5491
Entry nameRapamycin
Contig
Start / Stop / Direction7,356 / 8,555 / + [in whole cluster]
7,356 / 8,555 / + [in contig]
Location7356..8555 [in whole cluster]
7356..8555 [in contig]
TypeCDS
Length1,200 bp (399 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative two-component system histidine kinase
Product (GenBank)sensory protein kinase
GeneorfS
rapS
Gene (GenBank)orfS
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[7644502] The biosynthetic gene cluster for the polyketide immunosuppressant rapamycin. (Proc Natl Acad Sci U S A. , 1995)
[8635730] Organisation of the biosynthetic gene cluster for rapamycin in Streptomyces hygroscopicus: analysis of genes flanking the polyketide synthase. (Gene. , 1996)
Related Reference
ACC
P0A4I8
PmId
[8885276] The cutRS signal transduction system of Streptomyces lividans represses the biosynthesis of the polyketide antibiotic actinorhodin. (Mol Microbiol. , 1996)

close this sectionSequence

selected fasta
>putative two-component system histidine kinase [sensory protein kinase]
MRLNPWALLSRLPFRARLTAAFSALFLIAGIALLAFVVLLARHGTEQQAQGISVTYGDVP
SGSGAPMGPVRPTRPNLTQRAPGDVAMFQKIDQTVRAVQDTALRQMVLWSAVGLLAMALL
AGVLGWWLAGRALRPVASMTETARRISEQSLHQRLALTGPDDELHRLADTFDTMLDRLEK
SFESQRRFVANASHELKTPLTVQRTSLQVGLADPLPEGLADVREDLLTANHEAEQLINGL
LLLARSDRGLEKTQTMDVAAIVRLVSTGLTPLATKNGVRIDLDADTPLAVPGDPVLLRHL
LTNLVRNAIQYNHPGGHVRIRLDTPTVTVTNTGPHVSPEQIPDLFEPFHRLDGDRTATTG
HGLGLSIAHSIANAHHATLTAQPGTEGGLTLTLRFPCRR
selected fasta
>putative two-component system histidine kinase [sensory protein kinase]
GTGCGACTGAACCCATGGGCGCTGCTGAGCCGACTGCCCTTCCGCGCCCGCCTGACCGCG
GCCTTCTCCGCCCTCTTTCTGATCGCCGGCATCGCACTGCTCGCCTTCGTGGTGCTACTC
GCCCGCCACGGAACGGAGCAGCAGGCCCAGGGGATATCGGTCACGTACGGGGATGTGCCG
AGCGGCAGTGGGGCGCCCATGGGGCCCGTGCGCCCCACCCGGCCGAATCTCACACAGCGG
GCCCCGGGCGACGTCGCCATGTTCCAGAAGATCGACCAGACCGTGCGAGCCGTCCAGGAC
ACCGCGCTGCGCCAGATGGTGCTCTGGTCCGCCGTCGGCCTCCTCGCCATGGCGCTCCTT
GCCGGAGTGCTCGGCTGGTGGCTCGCCGGCCGAGCCCTGCGACCCGTCGCCTCCATGACC
GAAACCGCGCGCCGCATCAGCGAACAGAGCCTCCACCAGCGTCTCGCGCTCACCGGCCCC
GACGACGAACTCCACCGCCTCGCCGACACCTTCGACACCATGCTCGACAGGCTCGAGAAG
TCCTTCGAGAGCCAGCGCCGCTTCGTCGCCAACGCCTCCCACGAACTCAAGACCCCTCTC
ACGGTCCAGCGCACCAGCCTCCAGGTCGGGCTCGCCGACCCCCTCCCCGAGGGACTCGCA
GACGTCCGCGAGGACCTGCTCACCGCCAACCACGAGGCCGAACAGCTGATCAACGGCCTG
CTGCTGCTGGCGCGCAGCGACCGCGGCCTGGAGAAGACCCAGACCATGGACGTCGCGGCC
ATCGTCCGGCTCGTGTCCACCGGCCTCACCCCACTGGCAACGAAGAACGGCGTGCGCATC
GACCTCGACGCCGATACCCCGCTGGCCGTTCCCGGTGACCCGGTCCTGCTGCGCCACCTG
CTCACGAACCTGGTCCGCAATGCCATCCAGTACAACCACCCCGGTGGCCACGTCCGCATA
CGGCTCGATACCCCCACCGTGACGGTGACCAATACGGGCCCCCACGTGTCCCCGGAACAG
ATCCCCGACCTGTTCGAGCCCTTCCACCGCCTGGACGGGGACCGTACCGCCACCACCGGC
CACGGTCTGGGACTGTCCATCGCCCACTCGATCGCCAACGCCCACCACGCCACGCTGACG
GCACAACCCGGCACCGAAGGCGGACTCACCCTCACCCTGCGCTTCCCTTGCCGCCGTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003594 ATPase-like, ATP-binding domain (Domain)
 [292-399]  4.19999771339583e-37 SM00387
SM00387   HATPase_c
 [292-396]  3.90000000000001e-22 PF02518
PF02518   HATPase_c
 [253-398]  5.59999999999999e-31 G3DSA:3.30.565.10
G3DSA:3.30.565.10   ATP_bd_ATPase
 [251-399]  4.10001399699315e-35 SSF55874
SSF55874   ATP_bd_ATPase
IPR003660 HAMP linker domain (Domain)
 [130-183]  3.7999986264479e-14 SM00304
SM00304   HAMP
 [111-179]  5.00000000000001e-17 PF00672
PF00672   HAMP
 [130-183]  PS50885
PS50885   HAMP
IPR003661 Signal transduction histidine kinase, subgroup 1, dimerisation/phosphoacceptor domain (Domain)
 [184-249]  3.30000526807186e-17 SM00388
SM00388   HisKA
 [184-249]  7.4e-11 PF00512
PF00512   HisKA
IPR004358 Signal transduction histidine kinase-related protein, C-terminal (Domain)
 [325-339]  2.10000037262656e-05 PR00344 [343-353]  2.10000037262656e-05 PR00344 [359-377]  2.10000037262656e-05 PR00344
PR00344   BCTRLSENSOR
IPR005467 Signal transduction histidine kinase, core (Domain)
 [191-399]  PS50109
PS50109   HIS_KIN
IPR009082 Signal transduction histidine kinase, homodimeric (Domain)
 [166-249]  1.59999889349252e-16 SSF47384
SSF47384   His_kin_homodim
SignalP
 [1-41]  0.999 Signal
Bacteria, Gram-positive   
 [1-37]  0.997 Signal
Bacteria, Gram-negative   
 [1-34]  0.552 Signal
Eukaryota   
TMHMM
 [18-40]  Transmembrane (o-i) [107-129]  Transmembrane (i-o)
Transmembrane 2