close all open/close all

CDS information : Rapam_00090


close this sectionLocation

Organism
StrainNRRL 5491
Entry nameRapamycin
Contig
Start / Stop / Direction9,332 / 8,730 / - [in whole cluster]
9,332 / 8,730 / - [in contig]
Locationcomplement(8730..9332) [in whole cluster]
complement(8730..9332) [in contig]
TypeCDS
Length603 bp (200 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)
Gene
Gene (GenBank)orfU
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[7644502] The biosynthetic gene cluster for the polyketide immunosuppressant rapamycin. (Proc Natl Acad Sci U S A. , 1995)
[8635730] Organisation of the biosynthetic gene cluster for rapamycin in Streptomyces hygroscopicus: analysis of genes flanking the polyketide synthase. (Gene. , 1996)

close this sectionSequence

selected fasta
>hypothetical protein
MNAPTMGHRQAVHSPEDADHYSPQPALTGGFLLDAAVATRWSFLATPSEPGRGRRPGWLL
TTAIAAAAVVVVVVVVAVHFGTQRSSADSSPSAQGRPSGSAASPTAGKKPSASTQGPQGS
QKPQGPQKPQEKGAALKVIEATFELPTGKSVVAGARSLIMQEDGNLVVHDQDRKPRWAAM
TKGENNSARFQTDATCRLQQ
selected fasta
>hypothetical protein
ATGAATGCCCCAACCATGGGGCATCGACAGGCTGTCCATTCACCCGAAGACGCTGATCAT
TATTCTCCGCAGCCAGCGCTGACCGGCGGTTTCCTCCTCGACGCCGCGGTCGCAACACGG
TGGAGCTTCCTCGCCACCCCCTCCGAGCCCGGCCGGGGCCGTCGGCCCGGCTGGCTGCTG
ACCACGGCCATCGCGGCGGCCGCGGTCGTGGTCGTGGTGGTGGTGGTCGCCGTCCACTTC
GGTACGCAGCGTTCCTCGGCCGATTCCTCCCCGTCCGCGCAGGGGCGGCCATCCGGTTCG
GCCGCCTCGCCGACCGCGGGGAAGAAGCCGTCCGCCTCGACCCAGGGACCCCAGGGATCT
CAGAAGCCCCAGGGGCCCCAGAAGCCCCAGGAGAAGGGCGCGGCACTCAAGGTCATAGAG
GCCACGTTCGAGTTGCCCACCGGGAAGTCCGTGGTGGCCGGGGCCAGGAGTCTGATCATG
CAGGAAGACGGGAACCTGGTGGTCCACGACCAGGACCGCAAGCCACGCTGGGCTGCGATG
ACCAAGGGCGAGAACAACTCCGCCCGCTTCCAGACGGACGCAACCTGTCGTCTACAGCAG
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001480 Bulb-type lectin domain (Domain)
 [148-194]  7.19999999999999e-08 G3DSA:2.90.10.10
G3DSA:2.90.10.10   Bulb-type_lectin_dom
 [136-191]  2.6999988713206e-07 SSF51110
SSF51110   B_lectin
SignalP No significant hit
TMHMM
 [58-80]  Transmembrane (i-o)
Transmembrane 1