close all open/close all

CDS information : Rapam_00100


close this sectionLocation

Organism
StrainNRRL 5491
Entry nameRapamycin
Contig
Start / Stop / Direction10,131 / 9,337 / - [in whole cluster]
10,131 / 9,337 / - [in contig]
Locationcomplement(9337..10131) [in whole cluster]
complement(9337..10131) [in contig]
TypeCDS
Length795 bp (264 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)ketoreductase/dehydrogenase
Gene
Gene (GenBank)rapT
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[7644502] The biosynthetic gene cluster for the polyketide immunosuppressant rapamycin. (Proc Natl Acad Sci U S A. , 1995)
[8635730] Organisation of the biosynthetic gene cluster for rapamycin in Streptomyces hygroscopicus: analysis of genes flanking the polyketide synthase. (Gene. , 1996)
Related Reference
ACC
P0AEK2
PmId
[1556094] The gene encoding Escherichia coli acyl carrier protein lies within a cluster of fatty acid biosynthetic genes. (J Biol Chem. , 1992)
[11669613] Structure of beta-ketoacyl-[acyl carrier protein] reductase from Escherichia coli: negative cooperativity and its structural basis. (Biochemistry. , 2001)

close this sectionSequence

selected fasta
>putative oxidoreductase [ketoreductase/dehydrogenase]
MATTLEHRFAGQVALVTGGGSGIGAAVAHLLAAEGCAAVHVGDLNAEGVRTVASVIKGVA
HVVDVTDPRAVDAVVSSVLESEGRIDVVIHTAGVDDPDAKARILEAQESGEPVDVLTRLD
DAAWRRVMAVNLDGTFHVLRAAVRAMRPRGRGAIVTVGSSAAFDTLTGYPHYAASKAGVH
ALSQAVAKEAIAFGIRVNTVAPGPVDTPMAARTPDAVRQKMAESGASGYATPEELADNIC
YLASPAASNVVGAVLLSNGGRFTV
selected fasta
>putative oxidoreductase [ketoreductase/dehydrogenase]
ATGGCAACGACCCTTGAGCACCGCTTCGCGGGACAGGTCGCCCTCGTTACCGGGGGCGGG
TCAGGAATCGGGGCCGCGGTGGCGCACCTGCTCGCTGCCGAAGGATGTGCGGCTGTGCAC
GTGGGCGACCTCAACGCGGAGGGTGTTCGCACCGTCGCGTCCGTCATCAAAGGGGTTGCG
CACGTTGTCGATGTGACCGATCCGCGGGCCGTTGATGCCGTAGTGTCGTCCGTCCTCGAA
TCCGAAGGCCGTATCGACGTGGTCATCCACACGGCCGGGGTGGACGATCCCGACGCCAAG
GCGCGAATCCTCGAGGCTCAGGAGTCGGGCGAGCCGGTGGATGTGCTGACTCGACTCGAT
GACGCCGCCTGGCGCCGGGTGATGGCCGTGAACCTCGACGGTACTTTCCACGTTCTGCGA
GCCGCGGTGCGAGCCATGCGCCCACGCGGCAGGGGCGCCATCGTGACTGTTGGCTCGTCC
GCGGCGTTCGACACGCTCACGGGATATCCGCACTACGCCGCTTCCAAAGCCGGTGTGCAC
GCGCTGTCCCAGGCCGTGGCAAAAGAGGCCATCGCTTTCGGTATCCGCGTCAACACCGTC
GCTCCGGGGCCAGTGGACACACCGATGGCGGCGCGTACCCCGGACGCCGTCCGCCAGAAG
ATGGCCGAGTCGGGCGCGTCGGGATACGCGACGCCGGAGGAGCTCGCCGACAACATCTGC
TATCTGGCGTCGCCTGCCGCGTCCAATGTGGTTGGTGCGGTGCTGCTGAGCAACGGAGGC
CGGTTCACGGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [83-94]  7.49999605851445e-09 PR00080 [152-160]  7.49999605851445e-09 PR00080 [172-191]  7.49999605851445e-09 PR00080
PR00080   SDRFAMILY
 [13-189]  1.99999999999999e-25 PF00106
PF00106   adh_short
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [13-30]  3.80000697093588e-36 PR00081 [83-94]  3.80000697093588e-36 PR00081 [146-162]  3.80000697093588e-36 PR00081 [172-191]  3.80000697093588e-36 PR00081 [193-210]  3.80000697093588e-36 PR00081 [225-245]  3.80000697093588e-36 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [8-262]  2.09999999999996e-67 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [159-187]  PS00061
PS00061   ADH_SHORT
SignalP
 [1-38]  0.832 Signal
Eukaryota   
 [1-32]  0.519 Signal
Bacteria, Gram-positive   
TMHMM No significant hit