close all open/close all

CDS information : Rapam_00110


close this sectionLocation

Organism
StrainNRRL 5491
Entry nameRapamycin
Contig
Start / Stop / Direction41,245 / 10,574 / - [in whole cluster]
41,245 / 10,574 / - [in contig]
Locationcomplement(10574..41245) [in whole cluster]
complement(10574..41245) [in contig]
TypeCDS
Length30,672 bp (10,223 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase
Gene
Gene (GenBank)rapB
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[7644502] The biosynthetic gene cluster for the polyketide immunosuppressant rapamycin. (Proc Natl Acad Sci U S A. , 1995)
[8635756] Organization of the biosynthetic gene cluster for rapamycin in Streptomyces hygroscopicus: analysis of the enzymatic domains in the modular polyketide synthase. (Gene. , 1996)
[27246853] Protein-Protein Interactions, Not Substrate Recognition, Dominate the Turnover of Chimeric Assembly Line Polyketide Synthases. (J Biol Chem. , 2016)

close this sectionPKS/NRPS Module

5 malonyl-CoA
6 methylmalonyl-CoA
7 methylmalonyl-CoA
8 malonyl-CoA
9 malonyl-CoA
10 methylmalonyl-CoA
KS33..402
AT542..780
dh858..1002
KR1267..1443
ACP1535..1605
KS1626..1995
AT2135..2438
dh2478..2639
kr2919..3095
ACP3170..3244
KS3266..3633
AT3778..4081
DH4121..4282
ER4577..4882
KR4892..5068
ACP5158..5232
KS5254..5620
AT5756..5994
DH6072..6233
KR6510..6686
ACP6774..6848
KS6870..7238
AT7382..7620
DH7705..7866
KR8145..8321
ACP8409..8483
KS8505..8874
AT9012..9314
DH9362..9523
KR9800..9977
ACP10071..10141

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase]
MREDQLLDALRKSVKENARLRKANTSLRAAMDEPLAIVGMACRLPGGVSSPEDLWRLVES
GTDAISGFPADRGWDVENLYDPDPEAAGKSYCVQGGFLDSAGGFDASFFGISPREALAMD
PQQRLVLEASWEAFERAGIEPGSLRGSDTGVFMGAYPGGYGVGADLGGFGATAGAVSVLS
GRVSYFFGLEGPAVTVDTACSSSLVALHQAAYALRQGECSLALVGGVTVMATPQSFVEFS
RQRGLASDGRCKAFADSADGTGWAEGAGVLLVERLSDAQRKGHQVLAVVRGSAVNQDGAS
NGLSAPNGPSQQRVIRAALSNAGLSTAEVDVVEAHGTGTTLGDPIEAQALLATYGQDREQ
PLLLGSVKSNLGHTQAAAGVSGVIKMVMALQHVLVPRTLHVDEPSRHVDWTDGAVALVTE
NQPWPDMGRPRRAGVSSFGISGTNAHVILESAPPTQAVDDVPPAEAPVVASELVPLVISA
RTLPALVEYEDRLRAYLAASPGVDVRGVASTLAVTRSVFEHRAVLLGDDTVTGTTVSDPR
VVFVFPGQGSQRAGMGEELAAAFPVFARIHQQVWGLLDVPDLEVNETGYAQPALFALQVA
LFGLLESWGVRPDAVVGHSVGELAAGYVSGLWSLEDACTLVSARARLMQALPPGGVMVAV
PVSEDEARAVLGEGVEIAAVNGPSSVVLSGDETAVLQAAAALGKSTRLATSHAFHSARME
PMLEEFRTVAERLTYQTPRLAMAAGDRVTTAEYWVRQVRDTVRFGEQVASYEDAVFIELG
ADRSLARLVDGVAMLHTDHEAQAAISALAHLYVNGVTVDWTALLGDAPATRVLDLPTYAF
QHQRYWLEGADRAAAGGHPLLGPAVGLAEASGVLFTSQVSRSGDLWLQDQTVLPATAFAE
MALAAADETGCGLVEELTVEALLLLPDDGAVQVQTWVSEPDDAGRRQLSIHARYSDDELW
TRLATATLATTTGRVSGWQAGEAWPPAGAVPVEARVPSLRGVWRRGSEVFAEVALDDTHD
ATRFLLHPGLMTAAFAAVGEETPAAWQGLTLHARNAAELRVRLTSQDDETLSVEAVDSTG
LPVLTARSLALDAVPVNEPATSATDLLTLTWAGIATRQQQTGLTVGAFEDLAADGDAPVP
DVVVFTALPGNDDPLAQTRILTAQVLRTVQEWIGGERFSDSTLVVRTGTGLAAAAVSGLM
RSAQSEHPGRFILVESDDDALTPDQLAATVGLDEPRLRISDGRYEVPRLTRAHADEPEPE
RAWDPDGTVLITGGSGVLAGIVARHLVAERGVRHLLLLSRGTPDRALLSELAELGAAVDT
AACDVSDRAELARVLARVSPEHPLTAVIHTAGVVDDGVVESLSAQRLETVFRPKADGAWH
LHELTRDADLAAFVMYSSAAGVMAGAGQGNYAAANAFLDALAEERRAEGLPALAVAWGLW
EDASGLTAQLTDTDRDRIRRGGLRAISAEHGMRLFDNASRHSEPVLVAAPMEPVRDAEVP
ALLRSLHRPNVRRAALAGGAQWLAALAPEERAKALLKVVRDTAATVLGHADARTIPVTGA
FRDLGIDSLTAVELRNGLAKVTGLRLPATLVFDYPTPAVLAARLGELFTGENPVLVRTAS
VVGQDEPLAIVGMACRLPGGVSSPEDLWRLVESGTDAISGFPADRGWDAESLFDPDPDAV
GKSYCVEGGFLDSAASFDAGFFGISPREALAMDPQQRLIMEVSWEAFERAGIEPGSVRGS
DTGVFMGAYAGGYGAGADLGGFAATASATSVLSGRVSYFFGLEGPAITVDTACSSSLVAL
YQAGYALRQGECSLALVGGVTVMATPQSFVEFSRKSGLDSDGRCKAFADSADGTGWAEGV
GVLLVERLSDAQAKGHQVLAVVRSSAVNQDGASNGLSAPNGPSQQGVIRQALANAGLTTA
EVDVVEAHGTGTTLGDPIEAQAVIATYGQDRERPLLLGSLKSNIGHAQAASGVSGVIKMV
MALQHNTVPRTLHVDEPSRHVDWAAGAVELVRENQPWPGTDRPRRAGVSSFGVSGTNAHV
ILESAPPAQPAEEAQPVETPVVASDVLPLVISAKTQPALTEHEDRLRAYLAASPGVDTRA
VASTLAVTRSVFEHRAVLLGDDTVTGTAVSDPRVVFVFPGQGWQWLGMGSALRDSSIVFA
ERMAECAPALREFVDWDLFTVLDDPAVVDRVDVVQPASWRMMVSLAAVWQAAGVRPDAVI
GHSQGEIAAACVAGAVSMRDAARIVTLRSEAIARGLAGRGAMASVALPAQDVELVDGAWI
AAHNGPASTVIAGTPEAVDHVLTAHEARGVRVRRITVDYASHTPHVELIRDELLDITSDS
SSQAPVVPWLSTVDGSWVDSPLDVEYWYRNLREPVGFHPAVGQLQAEGDTVFVEVSASPV
LLQAMDDDVVTVATLRRDDGDATRMLTALAQAYVHGVTVDWPAILGTATTRVLDLPTYAF
QHQRYWLRSVDRAAADGHPLLGTVVDLPASDGVVLTGRVSLATHTWLADHAVRGSVLLPG
TAFVDLVVRAADEVESDVVDELVIETPLLLPQTGGVQLSVSVGGADESGHRAVMVFSQAD
NTDTWTRHVTATVSTSDSTVSLPEFASWPPAQARPVSVADFYDRLAAAGTEYGPAFQGLQ
AAWRDGDTVYAEVVLAEEQAQEAARFAVHPALLDAAMHASVLHTPDTDQQSVRMPFSWNH
VQIRATDTAMLRVAATPTTDGWSVRVADDTGRPVATIGSLVTRPVTADTLGSAADDLLTL
VWTEIPTPQQSSLSVGRYEDLADGDVPVPDVAVYTARPEADGSPDPLVQTRTLTAQVLQT
AQAWLGGERFTDSTLVVRTGTGLAAAAVSGLMRSAQSEHPGRFVLVESDDDSLTLHQLAA
TVGLDEPRLRVNDGRFEVPRLARVNAAEPESETVWDPHGTVLITGGSGVLAGALARHLVT
ERGVRHLLLLSRTTADEGLLNELGELGARVETADCDVSDRAGLARVLAGVSPEHPLTAVI
QTAGALDDGVLETLTAQRLDTVLRPKADGAWHLHELTRNTGLAAFVMYSSAAGVMGNPGQ
GNLAAATAFLDALADQRRAEGLPALALAWGSSEETSDLIGLRTISAERGMRLFDSASHRG
EPLLMAASLDPARAAEVPALLRSLRRPVARRAASADGGVQWLAALAPAEREKALLKVVCD
SAAVVLGHADARTIPVTGAFKDLGVDSLTAVELRNSLVKATGLRLPATMVFDYPTPTALA
ARLDELFTGENPAPVREPVPAVAQDEPLAIVGMACRLPGGVSSPEDLWRLVESGTDAVSG
FPTDRGWDVEGLFDPDPDAAGKSYRAEGGFLDTAAGFDAGFFGISPREALAMDPQQRLLL
EVSWEAFERAGIEPGSVRGSDTGVFIGAFPVGYGAGAAREGYGATAAPNVLSGRLSYFFG
LEGPAITMDTACSSSLVALHLAAQALRNGECSMALAGGVTVMATPEVFTEFARQRGLASD
GRCKAFADSADGAGFSEGAGLLLVERLSDARRNGHQVLAVVRGSAVNQDGASNGFTAPNG
PAQQRVIRQALANAGLTTAEVDVVEAHGTGTTLGDPIEAQAVIATYGQDREQPLLLGTLK
SNVGHTQAAAGVSGVIKMVMALQHSTVPRTLHVNEPSRHVDWSAGAVELVTENQSWPVTG
RPRRAGVSAFGVSGTNAHVVLESAPPAQSVNNAQPVATPVVASELVPLVISAKTLPALTE
HEDRLRAYLAASPGADMRAVGSTLALTRSVFEHRAVLLGHDTVTVTGTGTAVSNPRVVFV
FPGQGWQWLGMGSALRGSSVVFAERMAECAAALSEFVDWDLFAVLDDPAVVDRVDVVQPA
SWAVMVSLAAVWQADGVRPDAVIGHSQGEIAAACVAGAVSLRDAARSVTLRSQAIARGLA
GRGAMASVALPAHEIELVDGAWIAAHNGPASTVVAGAPEAVDRVLAVHEARGVRVRRIAV
DYASHTPHVELIRDELLDITAGIGSQAPVVPWLSTVDGTWVEGPLDVEYWYRNLREPVGF
DSAVGQLRAEGDTVFVEVSASPVLLQAMDDDVVTVATLRRDDGDATRMLTALAQAFVEGV
TVDWPAILGTATTRVPDLPTYAFQHQRFWAEGADRSVAGGHPLLGVAVELPESDGVLLTG
RVSLATHAWLADHAVRGSVLLPGTGFVELVVRAADEVGCDVVDELVIETPLLLPSSASVH
LSVSVGEADESGRRGVTVFSRADGADAWTRHVSATIGVSGAALSLPELAAWPPAQAQPVG
LGDFYDRLTGAGYEYGPAFQGLQAAWRDGDTVFAEVALAEEQAEEAARFAVHPALLDAAL
DAGILNTLDNAEQGVRLPFSWNGVQVRATGSATLRVADNPTSDGWSVRVADDSGRPVATV
DSLVTRPVTADTLGSAADDLLTVVWTEIPTPQQTGLSVGRFEDLADGDVPVPEVVVCTAL
PDSSENPLAPLDPPDPLVQTRTLTTQVLQAVQAWLAGERFTDSTLVVRTGTGLATAGVSG
LMRSAQSEHPGRFVLVECDDNLTLQQLAATVGLDEPRLRVCDGRFEVPRLARANTPESSP
LTIPGDRAWLLEQSHSGTLRDLALVPAETAERPLQSGEVRVDVRAAGLNFRDVLIALGTY
PGEAVIGAEAAGVVLEVGPEVQDLAPGDRVFGLVGGGFGAVAIADRRMLGVIPDGWSFTT
AASVPVVFATAYYGLVDLAGLSAGESVLIHAAAGGVGMAATQIARHLGARIYATASTGKQ
HVLREAGLEDARIGDSRTTGFREMVLDTTDSRGVDVVLNSLSGDFVDASLDLLPRGGRFV
EMGKTDIRDPHQVTADRPGTSYQAFDLMDAGPDRLREIIADLLALFAQGVLLPLPVRAWD
IRQAREAFSWMSRARHIGKIVLTVPQQLDANGTVLVTGGSGVLAGIAARHLVAEQGVRHL
LLLSRSTPDDALINELGELGARVDTAICDVSDRAGLARILAGVSPEHPLTAVIHTAGALD
DGVVESLTAQQLETVLRPKADGAWHLHELTRDADLAAFVMYSSAAGVLGSGGQGNYAAAN
AFLDALAEQRRGEGLPALAVAWGLWEDASGLTAEMTDTDRDRIRRGGLRAISAGHGMGLL
DAASRHGEPVLLAAAMEPVREAEVPALLRLLHRPVARRAASTGGSSVQWLARLAPVEREK
ALLKLVCDGAATVLGHADASTIPATAAFKDLGIDSLTAVELRNSLTKATGLRLPATLVFD
YPTPTALAARLGEWFVGETPVPVRTSVSVVAQDEPLAIVGMACRLPGGVSSPEDLWRLLE
SGTDAVSGFPTDRGWDVENLFGPAAGDSYRLQGGFLDAAAGFDASFFGISPREALAMDPQ
QRLVLEVSWEAFERAGIEPGSVRGTDTGVFMGAYPGGYGIGADLGGFGATASAVSVLSGR
VSYFFGLEGPAITVDTACSSSLVALHQAGYALRQGECSLALVGGVTVMATPQTFVEFARQ
GGLAGDGRSKAFADSADGAGFSEGVGVLLVERLSDAQAKGHQVLAMLRSSAVNQDGASNG
LTAPNGPSQQRVIQAALSNAGLAAHEVDVVEAHGTGTTLGDPIEAQALLATYGQDREQPL
LLGSVKSNLGHTQAAAGVSGVIKMVMALQRGFVPRTLHVDEPSRHVDWSAGAVALVTENQ
PWPDMGRARRAGVSSFGISGTNAHVILESAPPTQPADNAVIERAPEWLPMVISARTQSAL
TEHEGRLRAYLAASPGVDMRAVASTLAITRSVFEHRAVLLGDDTVTGTAATDPRVVFVFP
GQGSQRAGMGEELAAAFPVFARIHQQVWDLLDVPDLEVNETGYAQPALFALQVALFGLLE
SWGVRPDAVVGHSVGELAAGYVSGLWSLEDACTLVSARARLMQALPAGGVMVAVPVSEDE
ARAVLGEGVEIAAVNGPSSVVLSGDEAAVLQAAEGLGKWTRLATSHAFHSARMEPMLEEF
RAVAEGLTYRTPQVSMAAGDQLTTTEYWVRQVRDTVRFGEQVASYEDAVFVELGADRSLA
RLVDGVAMLHGDHEAQAAVSALAHLYVNGVTVDWPALLGDAPATRVLDLPTYAFQHQRYW
LEGTDRMAAGGHPLLGEAVAVPGSDGVLLTGRVSLATHPWLADHAVRGSVLLPGTGFVEL
VVRAADEVGCDVIDELVIETPLLLPQTGGVQLSVAVAESDDSGRRAVTVFSRADNVDTWT
RHATVTVSNSDTTLSLPDLSAWPPAQAQPVNVADFYDQLTVVAYEYGPAFQGLQAAWRDG
DTVHAEVALAEEQAQDAARNAVHPALLDAALHAGILNTPDTEQGVRLPFSWNQVQVHAVG
SAMLRVAVTQAADGWSVRVADDTGRPVATIGSLVTRPVTADTLGSTTDDLLALTWTEIPA
PQETSLTIGRFEDLADADVPVPEVVVFTARPDSSENPLAQTRTLTAQVLQKIQAWLAEER
FTDSTLIVRIGTGLAAAAVSGLMRSGQSEHPGRFVLVESDDDTLAPDQLAATVELDEPRL
RISDGRFEVPRLTRTHAAEPESEKVWDPDGTVLITGGSGVLAGIAARHLVAERGVRHLLL
LSRSAPDGALISELGELGAQVATAVCDVSDRPGLVRVLADVSPEHPLTAVIHTAGVVDDG
VVESLTAQRLDTVLRPKADGAWHLHELTRDADLAAFVMYSSAAGVFGSAGQGNYAVANAF
LDALAEQRRAEGLPALALAWGLWEGTSGLTANLTDTDHDRIRRSGMRAISAEHGMRLFDG
ASRRRDPVLVAAAMEPVREAEVPAMLRSLHRPVARRAASGGAVRCLAALAPEERAKALVK
VVCDSAATVLGHADVDSIPVTAAFRDLGVDSLTAVELRNSLTKATGLRLPATLVFDYPTP
GALAARLEELFTGENPVQVRTPVSAVGQDEPLAIVGMACRLPGGVSSPEDLWRLVESGTD
AISGFPTDRGWDVENLFDSDPDAAGKSYCVEGGFLATAANFDASFFGISPREALAMDPQQ
RLVLEVSWEAFERAGIEPGSVRGSDTGVFMGAFPGGYGIGADLEGYGATAGLNVLSGRLS
YFFGLEGPAVTVDTACSSSLVALHQAGYALRQGECSLALIGGVTVMATPHTFVEFSRQRG
LASDGRCKAFADSADGTGWSEGVGVLLVERLSDAQAKGHQVLAVVRSSAVNQDGASNGLS
APNGPSQQRVIRQALANAGLTTAEVDVVEAHGTGTTLGDPIEAQAVIATYGQDRDQPVLL
GSVKSNVGHTQAAAGVSGVIKMVMALQHGLVPRTLHVDEPSRHVDWTDGAVELVTENQSW
PEAGRPRRAGVSSFGVSGTNAHVILESAPPTQAVDDVRPADAPVVASVMASELVPLVISA
KTQSALAEYEGRLRAYLAASPGVDMRAVASTLAMTRSVFEHRAVIVGDDTVSGTAATDPR
VVFVFPGQGSQRAGMGAELAAAFPVFARIHQQVWDLLDVPDLEVNETGYAQPALFALQVA
LFGLLESWGVRPDAVIGHSVGELAAAYVSGLWSLEDACTLVSARARLMQALPAGGVMVAV
PVSEDEARAVLGEGVEIAAVNGPSSVVLSGDEAAVLQAAEGLGKWTRLATSHAFHSARME
PMLEEFRAVAQGLTYHAPGVVMAAGDRVMTAEYWVRQVRDTVRFGEQVASYEDAVFVELG
ADRSLARLVDGVAMLHGDHETQAAIGALAHLYVNGVTVDWTALLGDVPVTRVLDLPTYAF
QQQRYWAEVGRSADVSGAGLDAVGHPLLGAVVALPGSDGVLLTGRVSLATHAWLADHAVR
GSVLLPGTGFVELVVRAADEVGCDVVDELIVEAPLLLPQTGGVQVSVSVGEADESGHRVV
TIFSRADNADTWVRHVSAVISTSDSTVSLSEFASWPPAQAQPVDVTGFYDPLMAEGYEYG
PAFQGLQAAWRYGDTVFAEVALAEEQVREAARYPSVHPALLDAALHACTLECADAEVGVG
LPFSWDGVRVHAGGSAMLRVAVTQAADGWSVRVADEIGRPVANVGSLVTRPVTADALGSA
ADDLLALTWAEIPAPEGTGLTVGRFEELVSDGDVPVPEVAVFTALPDNDDDPLEQTRKLT
GQVLQAVQEWLGGERFSDSTLVVRTGTGLAAAGVSGLMRSAQSEHPGRFVLVESDDDALA
LDQLAAAVGLDEPRLRISDGRFEAPRLTRTHAAEPESEKVWDPDGTVLITGGSGVLAGIA
VRHLVTERGVRHLLLLSRSAPDEALINQLGELGARVETAACDVSDRAALAQVLAGVSPEH
PLTAVIHTAGVLDDGVVESLTAQRLDAVLRPKADGAWNLHELTRDADLAAFVMYSSAAGV
LGSGGQGNYAAANAFLDALAEQRHAEGLPALAVAWGLWEDASGLTAQLTDTDRDRIRRGG
LRAISAEHGMGLFDSASRHSEPVLVAAPMEPVRDAEVPALLRSLHRPVARRAAAAGGARW
LAALAPAEREKALLKLVSDGAATVLGHADTSTIPATTAFKDLGIDSLTAVELRNSLAKAT
ELRLPATLVFDYPTPTALAARLDELFTGENPAPVRGPVSAVAQDEPLAIVGMACRLPGGV
SSPEDLWRLVESGTDAISGFPTDRGWDVENLYDPDPDAPGKSYSVQGGFLDAAAGFDASF
FGISPREALAMDPQQRLMLEVSWEAFERAGIEPGSVRGSDTGVFIGAYPGGYGIGADLGG
FGTTAGAASVLSGRVSYFFGLEGPAFTVDTACSSSLVALHQAGYALRQGECSLALVGGVT
VMPTPQTFVEFSRQRGLSADGRCKAFADAADGTGWAEGVGVLLVERLSDAQANGHQILAV
VRSSAVNQDGASNGLSAPNGPSQQRVIRAALSNAGLAPHEVDVVEAHGTGTTLGDPIEAQ
AVIATYGQGRGEPLLLGSLKSNVGHTQAAAGVSGVIKMVMALQHSMVPRTLHVDEPSRHV
DWSAGAVELVAENQPWPETGRPRRAGVSSFGISGTNAHVILESAPAQSVGDTAGSTPVLV
SELVPLVISAKTQPALTEHEDRLRAYLAASPGVDIRAVASTLAVTRSVFEHRAVLLGDET
VTGTAVSDPRIVFVFPGQGWQWLGMGSALRDSSVVFAERMAECAAALSEFVDWDLFAVLD
DPAVVDRVDVVQPASWAVMVSLAAVWQAAGVRPDAVIGHSQGEIAAACVAGAVSMRDAAR
IVTLRSQAIARGLAGRGAMASVALPAQDVELVDGAWIAAHNGPASTVIAGTPEAVDHVLT
ALRQRGAGAADHVDYASHTPHVELIRDELLDITSDSSSQDPLVPWLSTVDGTWVDSPLDG
EYWYRNLREPVGFHPAVSQLQAQGDTVFVEVSASPVLMQAMDDDVVTVATLRRDDGDATR
MLTALAQAYVHGVTVDWRAVLGDVPATRVLDLPTYAFQHQRYWAEAGRSADVSAAGLDAV
GHPLLGAVLAMPGSDGVMLTGRVSLATHAWLADHAVRGSVLLPGTGFVELVVRAADEVAC
DVVDELIVEAPLLLPQTGGVQLSVSVGEADESGHRAVTVFSRADSADAWVRHVSATVSVS
DTTVPTSDLTAWPPAQAKPVDVAGFYDQLTRAGYEYGPAFQGLQAAWRDGDTVFAEVALA
EEQTQDAARFAVHPAVLDAALHAGILNTPDADRDTVRLPFSWNHVQVHVTGSATLRVAMT
RVADGWGVRVADDIGRPVATIGSLVTRPVAADALGSAVDDLFALTWTEIPVSQQVGVTVG
KFEDLADGEVPMPDVVVFTALPDSGDPLAQTRRLTAEVLQAVQVWLAGERFTDSTLVVRT
GTGLAAAAVSGLMRSAQSEHPGRFVLVESDDDTLTPDQLAATVGLDEPRLRVIDGRYEAP
RLTRTGVAEPEPEGVWDPDGTVLITGGSGVLAGIAARHLVAERGVRHLLLLSRSAPDEAL
ISELAELGAAVVDTAVCDVSDRAGLARVLAGVSPDHPLTAVIHTAGVLDDGVVESLTARR
LDTVLRPKADGAWNLHELTRDIDLAAFVMYSSAAGVLGSAGQGNYAVANAFVDALAEQRR
AEGLPALALAWGLWEDASGLTAKLTGTDHDRIRRSGLRTITAERGMRLFDIASRQGEPVL
VATPMEPVREVEVPALLRLLHRPVARRAASTGDSSAQWLVGLAPEERAKALLKVVRDSAA
TVLGHADARSIPATGAFKDLGVDSLTAVELRNSLTKATGLRLPATMVFDYPTPADLAARL
GDLMNPRVQSTTLLAEIDRIEKMFTSVTFDDRQASAIKDRLSSVLNKWQRISSPEEVSTT
ALSSASASEILDFIDREFGDPTA
selected fasta
>polyketide synthase [polyketide synthase]
ATGAGGGAAGATCAGCTTCTCGACGCATTGCGCAAGTCGGTCAAGGAGAACGCGCGGCTC
CGCAAGGCGAACACGTCGTTGCGGGCAGCCATGGACGAGCCGTTGGCGATTGTGGGTATG
GCGTGCCGTCTGCCGGGTGGGGTGTCGTCCCCGGAGGATCTGTGGCGCCTTGTCGAGTCG
GGTACGGACGCGATTTCCGGATTCCCCGCCGACCGTGGCTGGGACGTCGAGAACCTGTAC
GACCCTGATCCGGAGGCGGCAGGCAAGTCGTACTGCGTGCAGGGCGGCTTCCTGGACTCC
GCAGGCGGTTTCGACGCCTCGTTCTTCGGGATCAGTCCTCGTGAGGCGTTGGCGATGGAT
CCGCAGCAGCGGCTGGTCCTGGAGGCGTCCTGGGAAGCGTTCGAACGGGCCGGGATCGAA
CCCGGTTCCCTCCGCGGTAGCGACACCGGTGTTTTCATGGGTGCGTACCCCGGTGGCTAC
GGCGTTGGTGCCGACCTCGGCGGCTTCGGGGCAACTGCCGGTGCGGTGAGTGTCCTGTCG
GGTCGGGTGTCGTATTTCTTCGGTCTCGAGGGGCCGGCTGTCACGGTGGACACGGCGTGT
TCGTCGTCGTTGGTGGCGTTGCATCAGGCGGCGTATGCCCTGCGGCAGGGTGAGTGTTCG
CTGGCCCTGGTCGGTGGTGTCACTGTGATGGCCACGCCGCAAAGTTTCGTGGAGTTCTCG
CGGCAGCGTGGCCTGGCCTCCGACGGCCGGTGCAAGGCGTTCGCGGATAGTGCGGACGGC
ACGGGCTGGGCTGAAGGCGCCGGTGTGCTGCTGGTAGAGCGGCTGTCCGATGCCCAGCGC
AAGGGCCACCAGGTGCTTGCGGTGGTGCGGGGATCGGCGGTCAATCAGGACGGTGCGTCG
AACGGCCTGTCCGCGCCGAACGGTCCTTCGCAGCAGCGGGTGATCCGGGCGGCTCTCAGC
AATGCGGGTCTGAGTACGGCTGAGGTGGATGTGGTCGAGGCGCACGGCACGGGTACGACG
CTGGGTGACCCGATCGAGGCCCAGGCGCTGCTGGCGACCTATGGCCAGGATCGTGAGCAG
CCGTTGCTGTTGGGTTCGGTGAAGTCGAATCTGGGTCATACGCAGGCCGCTGCGGGTGTG
TCTGGTGTCATCAAGATGGTGATGGCGCTGCAGCACGTCTTGGTGCCGCGTACGTTGCAT
GTGGATGAGCCGTCGCGGCATGTGGACTGGACGGATGGCGCGGTTGCGCTGGTGACGGAG
AACCAGCCGTGGCCGGATATGGGTCGGCCTCGCCGGGCAGGTGTGTCGTCCTTCGGGATC
AGTGGCACCAACGCCCACGTCATCCTGGAAAGCGCACCCCCCACGCAGGCTGTGGACGAT
GTGCCGCCTGCGGAGGCGCCGGTGGTGGCGTCGGAGTTGGTGCCGCTGGTGATTTCGGCG
AGGACGTTGCCAGCTCTGGTCGAGTACGAGGACCGGCTGCGTGCGTATTTGGCGGCGTCG
CCTGGGGTGGACGTGCGGGGTGTGGCGTCAACGCTGGCGGTGACGCGTTCGGTGTTCGAG
CACCGGGCGGTGCTCCTTGGAGATGACACCGTTACCGGGACCACGGTGTCTGATCCGCGG
GTGGTGTTCGTCTTCCCGGGTCAGGGGTCGCAGCGTGCTGGTATGGGTGAGGAACTGGCC
GCCGCGTTCCCCGTCTTCGCGCGGATCCATCAGCAGGTGTGGGGCCTGCTGGACGTGCCC
GATCTGGAGGTGAACGAGACCGGCTATGCCCAGCCGGCCCTGTTCGCTTTGCAGGTGGCC
CTGTTCGGGTTGCTGGAATCGTGGGGTGTACGGCCGGACGCGGTGGTCGGTCACTCTGTC
GGTGAGCTCGCCGCCGGATACGTCTCCGGGTTGTGGTCGCTGGAGGATGCCTGCACGCTG
GTGTCGGCGCGGGCCCGCCTCATGCAGGCCCTGCCCCCGGGTGGGGTGATGGTCGCCGTC
CCGGTCTCCGAAGATGAGGCCCGGGCCGTGCTGGGTGAGGGTGTGGAGATCGCCGCGGTC
AACGGCCCGTCGTCGGTGGTTCTCTCCGGCGATGAAACCGCAGTACTGCAGGCCGCAGCA
GCCTTGGGCAAGTCAACACGTCTGGCAACCAGCCATGCCTTCCACTCCGCCCGCATGGAA
CCCATGCTGGAGGAGTTCCGGACGGTCGCCGAACGCCTCACCTACCAAACACCCCGCCTC
GCCATGGCCGCTGGTGATCGGGTGACGACGGCTGAGTACTGGGTGCGGCAGGTCCGGGAC
ACGGTCCGGTTCGGCGAGCAGGTGGCCTCGTACGAGGACGCGGTGTTCATCGAGCTGGGT
GCCGACCGGTCGCTGGCCCGCCTGGTCGACGGTGTCGCGATGCTGCACACCGACCACGAG
GCACAGGCCGCGATCAGTGCCCTGGCCCACCTGTATGTCAACGGCGTCACCGTCGACTGG
ACCGCGCTTCTGGGCGATGCTCCGGCAACACGGGTGCTGGACCTTCCGACATACGCCTTC
CAGCACCAGCGGTATTGGCTTGAGGGTGCGGACCGGGCGGCCGCGGGCGGTCATCCGCTG
CTCGGGCCGGCGGTAGGGCTGGCCGAGGCCAGTGGAGTGCTGTTTACCTCGCAAGTTTCC
CGGAGCGGTGATCTGTGGTTGCAGGACCAGACGGTCTTGCCCGCGACGGCGTTCGCCGAG
ATGGCGCTGGCAGCGGCGGACGAGACCGGCTGCGGCCTGGTCGAGGAACTCACCGTGGAA
GCCTTGCTGCTGCTTCCTGACGATGGCGCCGTCCAGGTACAGACCTGGGTGAGCGAACCC
GACGATGCCGGCCGCCGCCAGCTCAGTATCCACGCCCGTTACAGCGACGACGAGCTCTGG
ACACGCCTGGCCACCGCGACCCTGGCCACCACCACCGGCAGGGTGTCCGGCTGGCAGGCC
GGCGAGGCGTGGCCGCCGGCCGGTGCGGTCCCGGTCGAGGCCCGAGTACCGTCACTGCGC
GGGGTGTGGCGCCGTGGCAGCGAAGTGTTCGCCGAGGTCGCCCTGGACGACACCCACGAC
GCCACCAGGTTTTTGCTTCATCCCGGCCTGATGACTGCCGCCTTCGCCGCCGTAGGCGAG
GAGACTCCCGCCGCGTGGCAGGGCTTGACCCTGCACGCCCGCAACGCTGCCGAGCTGCGC
GTCCGCCTCACCTCACAGGATGACGAGACCCTGTCGGTAGAGGCCGTCGACAGCACAGGG
CTTCCTGTCCTGACCGCCCGCTCCCTCGCGCTGGACGCCGTTCCCGTCAACGAACCGGCC
ACCAGTGCCACCGACCTGCTCACCCTGACCTGGGCAGGAATCGCCACCCGCCAGCAGCAG
ACCGGTCTGACGGTGGGTGCGTTTGAAGACCTGGCGGCGGACGGCGATGCGCCGGTGCCC
GATGTCGTGGTGTTCACCGCGCTCCCCGGCAACGACGACCCGCTGGCACAGACTCGCATA
CTGACCGCGCAGGTTCTGCGGACAGTCCAGGAGTGGATTGGCGGGGAACGCTTCAGCGAC
AGCACGCTGGTGGTGCGGACCGGTACTGGTTTGGCCGCGGCAGCGGTGTCGGGGTTGATG
CGCTCGGCCCAGTCCGAACACCCCGGCCGGTTCATCCTGGTGGAAAGTGATGACGACGCC
CTCACTCCGGACCAGCTGGCCGCGACTGTCGGATTGGACGAGCCGCGGCTGCGGATCAGC
GACGGCCGGTACGAAGTACCACGGCTGACCCGCGCACATGCCGATGAGCCTGAGCCTGAA
AGGGCGTGGGATCCGGATGGCACGGTCCTGATCACGGGCGGTTCCGGCGTTCTGGCGGGG
ATCGTCGCCCGGCACCTGGTGGCCGAACGTGGTGTGCGTCATCTCCTGCTGCTGTCTCGC
GGCACTCCGGACCGGGCGCTGCTCAGCGAGTTGGCCGAGTTGGGTGCCGCGGTGGACACA
GCGGCCTGTGACGTGTCGGATCGTGCAGAGCTGGCGCGAGTGTTGGCGCGTGTGTCGCCG
GAGCACCCGTTGACGGCGGTGATTCATACCGCGGGCGTGGTGGATGACGGTGTCGTGGAG
TCCCTGAGCGCGCAGCGGCTGGAGACCGTATTCCGGCCCAAGGCCGATGGTGCTTGGCAT
TTGCACGAGCTCACCCGGGACGCCGACCTGGCGGCGTTCGTCATGTATTCCTCGGCTGCC
GGTGTCATGGCCGGTGCGGGTCAGGGTAACTACGCGGCGGCAAACGCGTTCCTGGACGCG
CTCGCCGAAGAACGCCGAGCCGAGGGCCTGCCCGCACTCGCGGTGGCCTGGGGCCTCTGG
GAGGACGCCAGCGGCCTGACCGCGCAACTGACCGACACGGACCGTGACCGGATCCGGCGC
GGTGGCCTGCGGGCCATCTCCGCCGAGCACGGGATGCGGCTGTTCGACAACGCGTCACGC
CACAGTGAACCGGTTCTGGTGGCCGCGCCGATGGAGCCGGTACGGGACGCGGAAGTCCCG
GCATTGCTGCGGTCGTTGCATCGTCCGAACGTCCGGCGTGCCGCTCTCGCCGGTGGAGCG
CAGTGGCTGGCAGCCCTGGCGCCGGAGGAGCGGGCGAAGGCACTGCTGAAGGTGGTGCGT
GACACCGCCGCGACGGTTCTGGGGCACGCCGATGCCCGCACCATTCCGGTGACCGGAGCG
TTCAGGGATCTGGGCATTGATTCGCTGACCGCGGTGGAACTACGGAACGGTCTGGCGAAG
GTGACGGGGTTGCGGTTGCCGGCCACGTTGGTGTTCGACTATCCGACCCCGGCGGTCTTG
GCTGCTCGGCTGGGGGAGTTGTTCACCGGCGAGAATCCTGTATTGGTGCGCACCGCCTCG
GTGGTGGGGCAGGACGAGCCGCTGGCGATCGTGGGTATGGCCTGCCGTCTGCCCGGCGGC
GTGTCGTCGCCTGAGGATCTGTGGCGCCTTGTGGAGTCGGGTACGGATGCGATTTCCGGT
TTCCCCGCCGACCGTGGGTGGGACGCGGAGAGCCTGTTCGATCCGGACCCGGACGCGGTC
GGGAAGTCGTACTGCGTAGAGGGCGGCTTCCTCGACAGCGCAGCCAGCTTCGACGCCGGA
TTCTTCGGCATCAGCCCACGCGAGGCTCTGGCGATGGACCCGCAGCAGCGGCTGATCATG
GAGGTGTCCTGGGAGGCCTTCGAGCGGGCCGGGATCGAGCCCGGTTCCGTGCGCGGCAGC
GACACCGGCGTCTTCATGGGCGCGTACGCCGGTGGCTACGGTGCCGGTGCTGACCTCGGC
GGCTTCGCGGCCACCGCCAGCGCGACCAGTGTCCTGTCCGGCCGGGTGTCGTACTTCTTC
GGCCTCGAAGGCCCCGCCATCACGGTGGACACGGCGTGTTCGTCGTCGCTGGTGGCATTG
TACCAGGCGGGGTATGCCCTGCGGCAGGGGGAGTGTTCCCTGGCCCTGGTCGGTGGTGTC
ACGGTGATGGCCACGCCGCAAAGTTTCGTGGAGTTCTCGCGGAAGAGTGGTCTTGACTCC
GATGGCCGGTGCAAGGCGTTCGCAGACAGCGCGGATGGCACGGGATGGGCTGAAGGCGTT
GGTGTGCTGCTGGTAGAGCGGCTTTCCGACGCCCAGGCCAAGGGCCATCAGGTGTTGGCG
GTGGTCCGTAGCTCGGCGGTCAACCAGGACGGCGCGTCGAACGGCCTGTCCGCGCCGAAC
GGCCCCTCCCAGCAGGGGGTGATTCGGCAGGCGCTGGCCAACGCGGGTCTGACCACGGCC
GAGGTGGATGTGGTCGAGGCCCACGGCACGGGTACGACGCTGGGCGACCCGATCGAGGCC
CAGGCGGTGATCGCCACTTACGGTCAGGACCGGGAACGGCCCCTGCTGCTGGGCTCGCTG
AAGTCGAACATCGGTCATGCTCAGGCCGCCTCGGGCGTGTCGGGTGTCATCAAGATGGTC
ATGGCCCTGCAGCACAACACGGTTCCCCGCACCCTGCACGTGGATGAGCCGTCGCGGCAC
GTGGACTGGGCGGCGGGTGCGGTTGAGCTGGTGAGGGAGAACCAGCCCTGGCCCGGCACC
GACCGGCCCCGTCGGGCGGGCGTGTCGTCCTTCGGAGTCAGCGGCACCAACGCCCACGTC
ATCCTGGAGAGCGCACCCCCCGCTCAGCCCGCGGAGGAGGCGCAGCCTGTTGAGACGCCG
GTGGTGGCCTCGGATGTGCTGCCGCTGGTGATATCGGCCAAGACCCAGCCCGCCCTGACC
GAACACGAAGACCGGCTGCGCGCCTACCTGGCGGCGTCGCCCGGAGTGGATACACGGGCT
GTTGCATCAACGCTCGCGGTGACACGGTCGGTGTTCGAGCACCGCGCCGTACTCCTTGGA
GACGACACCGTCACCGGCACCGCTGTGTCCGATCCCCGGGTGGTGTTTGTTTTCCCGGGG
CAGGGGTGGCAGTGGCTGGGGATGGGCAGTGCGCTGCGCGATTCCTCGATCGTGTTCGCC
GAGCGGATGGCCGAGTGCGCGCCCGCGTTGCGCGAGTTCGTGGACTGGGACCTGTTCACG
GTTCTGGATGATCCGGCGGTGGTGGACCGGGTTGATGTGGTCCAGCCCGCTTCCTGGCGG
ATGATGGTCTCCCTGGCCGCGGTGTGGCAGGCGGCCGGTGTGCGGCCGGATGCGGTGATC
GGCCATTCACAGGGTGAGATCGCCGCGGCGTGTGTGGCGGGTGCGGTGTCGATGCGGGAT
GCCGCCCGGATCGTGACCTTGCGCAGCGAGGCGATCGCCCGGGGCCTGGCGGGCCGGGGC
GCGATGGCATCCGTCGCCCTGCCCGCACAGGATGTCGAGCTGGTCGACGGGGCCTGGATC
GCCGCCCACAACGGTCCCGCCTCCACCGTGATCGCGGGCACCCCGGAAGCGGTCGACCAT
GTCCTCACCGCTCATGAAGCGCGAGGGGTGCGGGTGCGGCGGATCACCGTCGACTACGCC
TCGCACACCCCGCACGTCGAGCTGATCCGCGACGAACTGCTCGACATCACTAGCGACAGC
AGCTCGCAGGCCCCGGTCGTGCCGTGGCTGTCGACCGTGGACGGCTCCTGGGTCGACAGC
CCGCTCGATGTGGAGTACTGGTACCGGAACCTGCGTGAGCCGGTCGGTTTCCACCCCGCC
GTCGGCCAGTTGCAGGCCGAGGGTGACACCGTGTTCGTGGAGGTCAGCGCCAGCCCGGTG
TTGTTGCAGGCGATGGACGACGATGTCGTCACGGTTGCCACGCTGCGTCGTGACGACGGC
GACGCCACCCGGATGCTCACCGCCCTGGCACAGGCCTATGTCCACGGCGTCACCGTCGAC
TGGCCCGCCATCCTCGGCACCGCCACAACCCGGGTACTGGACCTTCCGACCTACGCCTTC
CAGCACCAGCGGTACTGGCTCAGGAGCGTGGACCGGGCGGCTGCCGACGGTCATCCACTG
CTGGGCACCGTAGTGGACCTGCCGGCCTCCGACGGTGTGGTGCTCACCGGGCGGGTGTCG
CTGGCCACCCATACATGGCTGGCCGATCACGCGGTCCGGGGCAGTGTCCTGCTACCCGGG
ACCGCATTTGTGGACCTGGTCGTCCGCGCCGCCGACGAGGTCGAGTCCGACGTCGTTGAC
GAGTTGGTGATCGAAACCCCGCTCCTGCTGCCGCAGACCGGAGGCGTCCAACTGTCCGTG
TCCGTCGGCGGAGCCGACGAGTCCGGGCACCGCGCGGTGATGGTCTTCTCCCAGGCGGAC
AACACCGATACCTGGACCCGGCACGTCACGGCGACAGTCAGCACCTCTGACTCGACGGTC
TCGCTGCCGGAGTTTGCCTCGTGGCCACCAGCCCAGGCCCGGCCGGTGAGCGTGGCCGAC
TTCTACGACCGGCTGGCTGCGGCAGGTACCGAGTACGGTCCCGCGTTCCAGGGGCTGCAG
GCCGCGTGGCGTGACGGGGACACCGTCTACGCCGAGGTCGTCCTCGCTGAGGAGCAGGCG
CAGGAGGCGGCACGGTTCGCGGTGCATCCGGCGCTGTTGGACGCCGCCATGCACGCCAGC
GTCCTGCACACACCCGATACCGACCAGCAGAGCGTGCGGATGCCGTTCTCCTGGAACCAC
GTCCAAATCCGAGCGACCGACACAGCCATGCTGCGCGTCGCGGCAACACCGACAACAGAC
GGCTGGAGTGTGCGGGTCGCCGACGACACCGGCAGGCCCGTGGCCACCATCGGTTCCCTC
GTCACCCGGCCGGTGACAGCCGACACACTCGGCTCCGCTGCCGATGACCTGCTCACGCTG
GTATGGACGGAGATCCCGACTCCCCAGCAGAGCAGCCTGAGCGTCGGCAGGTACGAAGAC
CTGGCGGACGGTGACGTGCCGGTCCCCGACGTGGCGGTCTACACCGCACGTCCCGAGGCC
GACGGCAGCCCTGATCCGCTGGTACAGACTCGTACGCTGACCGCCCAGGTGCTCCAGACG
GCCCAGGCGTGGCTTGGCGGGGAGCGCTTCACCGACAGCACACTGGTCGTGCGGACCGGC
ACCGGGCTGGCCGCCGCCGCGGTGTCAGGGCTGATGCGTTCAGCCCAGTCGGAACACCCC
GGCCGCTTCGTCCTGGTGGAAAGCGACGACGACAGCCTCACCCTCCACCAACTGGCCGCT
ACCGTCGGACTGGACGAGCCCCGCCTGCGGGTCAACGACGGCCGGTTCGAAGTGCCACGG
CTGGCCCGGGTGAACGCCGCTGAGCCCGAATCTGAAACGGTGTGGGACCCGCATGGCACG
GTCCTGATCACAGGCGGCTCCGGCGTCCTGGCAGGCGCCCTCGCCCGCCACCTGGTCACC
GAACGTGGCGTACGTCATCTCCTGCTGCTGTCCCGCACCACTGCCGACGAGGGGTTGCTC
AACGAACTCGGCGAGCTGGGCGCTCGGGTCGAGACGGCGGACTGCGACGTGTCGGACCGT
GCCGGGCTGGCGCGGGTGCTGGCGGGCGTATCACCGGAACACCCGCTGACGGCGGTGATC
CAAACCGCCGGCGCACTCGACGACGGCGTCTTGGAGACCCTGACCGCGCAGCGGCTGGAC
ACGGTCCTACGGCCCAAAGCCGACGGCGCCTGGCACCTGCACGAACTCACTCGCAACACC
GGCCTGGCCGCGTTCGTCATGTATTCCTCGGCCGCCGGTGTCATGGGTAATCCGGGGCAG
GGCAACCTCGCGGCGGCCACCGCGTTCTTGGACGCGCTGGCCGACCAACGTCGTGCCGAG
GGGCTGCCCGCACTCGCACTCGCCTGGGGTTCGTCAGAAGAGACCAGTGACCTGATCGGT
CTGCGGACCATCTCCGCCGAGCGTGGGATGCGCCTGTTCGACAGCGCATCGCATCGTGGC
GAGCCGCTTCTGATGGCCGCGTCGCTGGATCCGGCACGGGCCGCGGAGGTTCCGGCGTTG
CTGCGTTCGTTGCGTCGCCCGGTCGCCCGGCGGGCCGCTTCCGCCGACGGTGGGGTGCAG
TGGCTGGCCGCCCTGGCACCGGCCGAGCGGGAGAAGGCGCTGCTGAAGGTGGTGTGTGAC
AGTGCCGCCGTGGTCCTGGGGCACGCCGACGCCCGCACCATTCCCGTGACCGGTGCGTTC
AAGGATTTGGGCGTGGATTCGCTGACCGCGGTGGAGCTGCGGAACAGCCTGGTGAAGGCG
ACGGGGCTGCGGCTGCCCGCCACGATGGTGTTCGACTATCCCACCCCGACCGCCTTGGCT
GCTCGGTTGGACGAGTTGTTCACCGGCGAGAACCCTGCACCGGTACGCGAGCCGGTGCCG
GCGGTGGCGCAGGACGAGCCGTTGGCGATTGTCGGTATGGCGTGCCGTCTGCCGGGCGGT
GTGTCGTCGCCGGAGGATCTGTGGCGCTTGGTCGAGTCGGGTACGGACGCGGTCTCCGGC
TTTCCCACCGACCGTGGCTGGGACGTCGAGGGCCTGTTCGATCCGGATCCGGACGCGGCC
GGGAAGTCGTACCGCGCTGAGGGCGGCTTCCTGGACACGGCGGCTGGCTTCGACGCCGGA
TTCTTCGGGATCAGTCCGCGTGAGGCGTTGGCGATGGATCCGCAGCAGAGGCTGCTGTTG
GAGGTGTCCTGGGAGGCCTTCGAGCGGGCCGGGATCGAGCCCGGTTCCGTACGCGGCAGC
GACACCGGCGTCTTCATTGGCGCGTTCCCCGTTGGTTACGGCGCCGGTGCTGCCCGCGAG
GGTTACGGTGCGACCGCGGCTCCCAACGTGTTGTCCGGCCGGCTGTCGTACTTCTTCGGC
CTTGAGGGTCCGGCGATCACGATGGACACGGCGTGCTCCTCGTCCCTGGTTGCTTTGCAT
CTGGCGGCGCAGGCGTTGCGCAATGGTGAGTGTTCGATGGCGTTGGCCGGTGGTGTGACG
GTGATGGCCACGCCGGAGGTCTTCACCGAGTTCGCCCGGCAGCGTGGTCTGGCCTCCGAC
GGCCGGTGCAAGGCGTTCGCGGACAGTGCGGATGGTGCCGGTTTCTCCGAAGGCGCGGGT
CTGCTGCTGGTCGAGCGGCTCTCCGACGCCCGCCGCAACGGCCACCAGGTGCTCGCAGTC
GTTCGCGGATCGGCAGTCAACCAAGACGGCGCGTCCAACGGCTTCACGGCGCCGAACGGA
CCCGCCCAGCAGCGGGTGATCCGGCAGGCGCTGGCCAACGCGGGTCTGACCACCGCCGAG
GTGGATGTGGTCGAGGCACACGGCACGGGTACGACGCTGGGTGACCCGATCGAGGCCCAG
GCGGTGATCGCCACCTACGGTCAGGACCGTGAGCAGCCTCTGCTGCTGGGCACATTGAAG
TCGAACGTCGGACATACGCAGGCTGCCGCAGGTGTGTCGGGTGTCATCAAGATGGTGATG
GCCCTGCAGCACAGCACGGTGCCGCGCACCCTGCATGTGAACGAGCCGTCGCGGCATGTG
GACTGGTCGGCGGGTGCGGTTGAGCTGGTGACGGAAAACCAGTCCTGGCCCGTCACCGGT
CGGCCGCGCCGGGCGGGTGTGTCGGCCTTCGGGGTCAGTGGTACGAACGCGCATGTCGTC
CTTGAGAGCGCACCACCCGCCCAGTCTGTGAACAACGCGCAGCCCGTAGCGACACCAGTT
GTGGCCTCGGAGCTGGTGCCGCTGGTGATATCAGCCAAGACGCTCCCGGCGCTGACCGAA
CACGAGGACCGGCTGCGCGCCTACCTGGCGGCGTCGCCCGGGGCGGATATGCGGGCTGTG
GGGTCGACGCTGGCGCTGACGCGTTCGGTGTTCGAGCACCGTGCCGTACTCCTCGGCCAC
GACACCGTCACCGTCACCGGTACCGGCACGGCGGTGTCCAACCCCCGAGTGGTGTTCGTT
TTTCCGGGGCAGGGGTGGCAGTGGCTGGGGATGGGCAGTGCGCTGCGGGGTTCGTCGGTG
GTGTTCGCCGAGCGGATGGCCGAGTGTGCGGCGGCGTTGAGTGAGTTTGTGGACTGGGAT
CTGTTCGCGGTGCTGGATGATCCGGCGGTGGTGGACCGGGTCGATGTGGTTCAGCCTGCT
TCGTGGGCGGTGATGGTTTCCCTGGCCGCGGTGTGGCAGGCGGACGGTGTGCGGCCTGAT
GCGGTGATCGGCCATTCGCAGGGTGAGATCGCCGCGGCGTGTGTGGCCGGTGCGGTGTCG
TTGCGGGATGCCGCCAGATCCGTGACCTTGCGCAGCCAGGCGATCGCCCGCGGCCTGGCG
GGCCGGGGCGCGATGGCATCCGTCGCCCTGCCCGCGCACGAGATCGAGCTGGTCGACGGG
GCCTGGATCGCCGCCCACAACGGTCCCGCGTCTACGGTGGTTGCGGGTGCGCCGGAGGCG
GTGGACCGTGTGCTGGCGGTTCATGAGGCGCGGGGGGTGCGGGTGCGGCGGATCGCCGTT
GACTACGCCTCGCACACGCCGCACGTCGAGCTGATCCGTGACGAGCTGCTCGACATCACC
GCGGGTATCGGTTCGCAGGCTCCGGTGGTGCCGTGGCTGTCGACCGTTGATGGGACGTGG
GTCGAGGGTCCGCTCGATGTGGAGTACTGGTACCGGAACCTGCGTGAACCGGTGGGCTTC
GACTCCGCCGTCGGCCAGTTGCGTGCTGAGGGCGACACCGTGTTCGTGGAGGTCAGCGCG
AGTCCGGTGTTGTTGCAGGCGATGGACGACGATGTCGTCACGGTTGCCACGCTGCGTCGT
GACGACGGGGACGCCACCCGGATGCTCACCGCCCTGGCACAGGCGTTTGTCGAGGGCGTG
ACCGTCGACTGGCCCGCAATCCTGGGCACCGCCACGACACGGGTACCGGACCTTCCGACG
TACGCGTTCCAGCACCAGCGCTTCTGGGCCGAGGGTGCGGACCGGTCGGTTGCGGGCGGT
CATCCGTTGCTGGGTGTGGCGGTGGAGTTGCCTGAGTCCGATGGTGTGCTGTTGACCGGG
CGGGTATCACTGGCCACGCATGCCTGGCTGGCTGATCACGCGGTGCGGGGCAGTGTGCTG
CTGCCCGGTACCGGGTTTGTGGAGCTGGTCGTCCGCGCCGCTGATGAGGTGGGGTGTGAC
GTGGTCGATGAGCTGGTGATCGAAACCCCGCTGCTGCTGCCGTCGTCCGCTAGCGTGCAC
CTGTCCGTGTCGGTCGGCGAGGCTGACGAATCCGGGCGCCGGGGTGTGACGGTCTTTTCC
CGTGCGGATGGCGCCGACGCCTGGACTCGCCACGTTTCGGCCACGATCGGCGTCTCTGGC
GCTGCCCTCTCGCTGCCAGAGCTTGCTGCTTGGCCTCCCGCACAGGCACAGCCGGTGGGC
CTGGGCGATTTCTACGACCGGCTGACCGGGGCCGGTTACGAGTACGGTCCCGCGTTCCAG
GGGCTGCAGGCCGCGTGGCGTGACGGGGACACCGTCTTCGCCGAGGTGGCCCTGGCCGAG
GAGCAGGCGGAGGAGGCGGCACGGTTCGCGGTGCATCCGGCGCTGTTGGACGCCGCCTTG
GACGCCGGAATTCTGAACACACTCGACAACGCCGAGCAGGGTGTGCGGTTGCCGTTCTCC
TGGAACGGTGTCCAGGTCCGGGCCACTGGATCGGCCACGCTACGCGTTGCGGATAACCCA
ACCAGTGACGGCTGGAGTGTGCGGGTCGCCGACGACAGCGGCCGACCGGTGGCTACCGTC
GACTCGCTCGTAACGCGGCCGGTAACGGCCGACACGCTCGGTTCCGCTGCCGACGACCTG
CTCACGGTGGTCTGGACGGAGATCCCCACCCCCCAGCAGACCGGCCTGAGCGTCGGCCGG
TTCGAAGACCTGGCGGACGGTGATGTGCCGGTGCCCGAGGTGGTGGTCTGCACCGCACTC
CCCGACAGCAGCGAGAACCCGCTAGCCCCGCTGGATCCGCCGGATCCGCTGGTACAGACC
CGCACGTTGACCACCCAGGTTCTCCAGGCAGTTCAGGCATGGCTGGCCGGGGAACGTTTC
ACCGACAGCACGCTGGTCGTGCGGACCGGCACCGGGCTGGCCACCGCCGGGGTGTCGGGT
CTGATGCGGTCTGCCCAGTCGGAACACCCCGGCCGGTTCGTCCTGGTGGAATGCGACGAC
AACCTCACCCTCCAGCAACTGGCCGCGACTGTCGGGTTGGACGAGCCGCGGCTGCGGGTC
TGCGACGGCCGGTTCGAGGTACCGCGGCTGGCGCGGGCGAATACGCCGGAAAGCAGCCCG
CTCACGATTCCCGGGGATCGTGCGTGGCTGCTGGAGCAGTCCCACAGCGGAACCTTACGG
GACCTCGCGCTGGTACCCGCCGAAACCGCCGAACGGCCCCTGCAATCCGGTGAAGTACGA
GTAGACGTACGCGCCGCAGGCCTGAACTTCCGCGATGTTCTCATCGCGCTCGGCACTTAC
CCCGGTGAGGCTGTGATCGGGGCTGAGGCTGCGGGCGTGGTGCTCGAGGTCGGTCCGGAG
GTCCAGGATCTGGCCCCGGGAGACCGAGTGTTCGGTCTTGTGGGCGGTGGGTTCGGGGCG
GTCGCGATCGCTGATCGCCGAATGCTGGGTGTGATTCCTGACGGGTGGTCGTTCACTACG
GCGGCGTCCGTGCCGGTTGTGTTCGCCACCGCGTATTACGGGCTGGTGGATCTGGCCGGG
CTGAGTGCGGGTGAGTCTGTGCTGATCCACGCCGCCGCGGGTGGTGTCGGCATGGCAGCC
ACCCAGATCGCCCGCCACCTCGGCGCGCGGATCTACGCGACGGCCAGCACCGGTAAGCAG
CACGTCCTGCGCGAGGCGGGTCTGGAGGATGCCCGGATCGGGGACTCGCGTACCACTGGC
TTCCGGGAAATGGTTCTGGACACCACTGACAGCCGGGGTGTCGATGTCGTCCTGAACTCC
CTCAGCGGTGACTTTGTCGATGCCTCGCTTGATCTGCTGCCTCGTGGTGGCCGGTTCGTC
GAGATGGGCAAGACCGACATCCGTGACCCGCACCAGGTCACCGCCGACCGGCCGGGTACC
AGCTACCAGGCGTTCGATCTGATGGACGCCGGTCCGGACCGGCTGCGGGAGATCATCGCC
GATTTGCTCGCCCTGTTCGCGCAGGGTGTGCTATTGCCCCTGCCGGTGCGGGCCTGGGAC
ATCCGTCAGGCCCGTGAGGCGTTCAGCTGGATGAGCCGTGCCCGCCACATCGGCAAGATC
GTCCTCACCGTCCCTCAGCAACTCGACGCCAACGGCACGGTTCTGGTCACCGGTGGTTCA
GGTGTCCTGGCGGGGATCGCGGCCCGGCATCTGGTGGCCGAGCAGGGTGTGCGTCATCTC
CTGCTGCTGTCCCGCAGTACCCCGGACGATGCGCTGATCAACGAGCTCGGTGAGCTGGGC
GCCCGGGTCGACACGGCGATCTGCGACGTGTCCGATCGTGCCGGGCTGGCACGGATACTC
GCCGGTGTATCACCAGAGCATCCGTTGACCGCGGTGATTCACACCGCCGGCGCACTTGAC
GACGGCGTCGTGGAGTCCCTGACCGCGCAGCAGCTGGAGACGGTACTGCGGCCCAAGGCC
GACGGCGCCTGGCACCTGCACGAGCTCACCCGGGACGCCGACCTGGCGGCGTTCGTCATG
TACTCCTCCGCCGCCGGTGTGCTCGGCAGCGGGGGACAGGGCAACTACGCGGCGGCCAAC
GCGTTCCTGGATGCCTTGGCTGAGCAGCGTCGTGGTGAGGGGCTGCCCGCGCTGGCGGTG
GCGTGGGGTCTGTGGGAGGACGCCAGCGGCCTGACCGCCGAAATGACTGACACGGACCGT
GACCGGATCCGGCGTGGTGGCCTGCGGGCGATCTCCGCGGGGCATGGGATGGGCTTGCTC
GATGCCGCGTCACGTCATGGTGAGCCGGTGCTGCTCGCTGCGGCGATGGAGCCTGTGCGT
GAGGCCGAGGTTCCGGCGCTGCTGCGTTTGTTGCATCGTCCGGTTGCCCGGCGGGCTGCT
TCTACCGGCGGCTCGTCGGTGCAGTGGCTGGCCCGGTTGGCGCCGGTGGAGCGGGAGAAG
GCGCTGCTGAAGCTGGTGTGTGATGGCGCCGCGACGGTTCTGGGACATGCCGACGCCAGC
ACGATTCCGGCGACCGCGGCGTTCAAGGATCTGGGCATCGATTCGCTGACCGCGGTGGAA
CTGCGGAACAGCCTGACGAAGGCCACGGGGCTGCGGTTGCCCGCCACGCTGGTGTTCGAC
TACCCCACCCCGACGGCCTTGGCAGCCCGGCTGGGGGAGTGGTTCGTCGGTGAAACTCCT
GTTCCGGTACGTACGTCGGTGTCGGTGGTGGCGCAGGACGAGCCGTTGGCGATTGTCGGC
ATGGCGTGTCGCTTGCCGGGTGGGGTGTCGTCGCCTGAGGATCTGTGGCGTCTTCTGGAG
TCGGGTACGGACGCGGTCTCCGGATTCCCCACCGATCGTGGCTGGGATGTGGAGAATCTG
TTCGGCCCCGCAGCTGGCGACTCCTATCGCTTGCAGGGTGGTTTCCTGGATGCCGCGGCT
GGTTTCGATGCCTCGTTCTTCGGGATCAGTCCGCGTGAGGCGTTGGCGATGGATCCGCAG
CAGCGGTTGGTGCTGGAGGTGTCCTGGGAGGCGTTTGAGCGGGCCGGGATCGAGCCCGGT
TCCGTACGCGGAACTGATACCGGGGTTTTCATGGGTGCGTACCCCGGTGGCTACGGCATC
GGTGCCGACCTCGGCGGCTTCGGCGCCACCGCGAGCGCGGTCAGTGTCCTGTCCGGCCGG
GTGTCGTACTTCTTCGGCCTCGAAGGCCCTGCCATCACGGTGGACACGGCGTGTTCGTCG
TCGTTGGTGGCGTTGCACCAGGCGGGGTATGCCCTGCGGCAGGGTGAGTGTTCGCTGGCC
CTGGTCGGTGGTGTCACCGTGATGGCCACGCCGCAGACTTTCGTGGAGTTCGCTCGTCAG
GGTGGCCTGGCCGGTGACGGTCGCAGTAAGGCGTTCGCGGACAGTGCGGACGGCGCCGGC
TTCTCCGAAGGTGTCGGTGTGTTGTTGGTGGAGCGTTTGTCGGACGCTCAGGCCAAGGGC
CACCAGGTGCTGGCGATGCTGCGCAGTTCGGCGGTCAACCAGGACGGTGCGTCGAACGGT
CTGACCGCGCCGAATGGCCCTTCCCAGCAGCGGGTGATCCAGGCTGCCCTCAGCAACGCC
GGCCTTGCGGCACACGAGGTGGATGTGGTCGAGGCGCACGGCACGGGTACGACGCTGGGT
GACCCGATCGAGGCCCAGGCGTTGCTGGCGACCTATGGCCAGGATCGTGAGCAGCCGTTG
CTGCTGGGTTCGGTGAAGTCGAATCTGGGTCATACGCAGGCTGCTGCGGGTGTGTCGGGT
GTCATCAAGATGGTGATGGCGCTGCAGCGCGGTTTCGTGCCGCGTACGTTGCATGTGGAT
GAGCCGTCGCGGCATGTGGACTGGTCGGCGGGCGCGGTTGCGCTGGTGACGGAGAACCAG
CCGTGGCCGGATATGGGCCGAGCGCGCCGGGCAGGCGTGTCGTCCTTCGGGATCAGTGGC
ACCAACGCCCACGTCATCCTGGAAAGCGCACCCCCCACTCAGCCTGCGGACAACGCGGTG
ATCGAGCGGGCACCGGAGTGGCTGCCGATGGTGATTTCGGCCAGGACCCAGTCGGCTTTG
ACTGAGCACGAGGGCCGGTTGCGTGCGTATCTGGCGGCGTCGCCCGGGGTGGATATGCGG
GCTGTGGCATCGACGCTGGCGATCACACGGTCGGTGTTCGAGCACCGGGCCGTGCTGCTG
GGAGATGACACCGTCACCGGTACCGCGGCGACCGATCCGCGGGTGGTGTTCGTCTTCCCG
GGTCAGGGGTCGCAGCGTGCTGGTATGGGTGAGGAACTGGCCGCCGCGTTCCCCGTCTTC
GCGCGGATCCATCAGCAGGTGTGGGACCTGCTCGATGTGCCCGATCTGGAGGTGAACGAG
ACCGGGTATGCCCAGCCGGCCCTGTTCGCTTTGCAGGTGGCTCTGTTCGGGTTGCTGGAA
TCGTGGGGTGTACGGCCGGATGCGGTGGTCGGTCACTCTGTCGGTGAGCTCGCCGCCGGA
TACGTCTCCGGGTTGTGGTCGTTGGAGGATGCCTGCACTTTGGTGTCGGCGCGGGCTCGT
CTGATGCAGGCTCTGCCTGCGGGTGGGGTGATGGTCGCTGTCCCGGTCTCGGAGGATGAG
GCCCGGGCCGTGCTGGGTGAGGGTGTGGAGATCGCCGCGGTCAACGGGCCGTCGTCGGTG
GTTCTCTCCGGTGATGAGGCCGCCGTGCTGCAGGCCGCGGAGGGGCTGGGGAAGTGGACG
CGGCTGGCGACCAGCCACGCGTTCCATTCCGCCCGTATGGAGCCGATGCTGGAGGAGTTC
CGGGCGGTCGCCGAAGGCCTGACCTACCGGACGCCGCAGGTCTCCATGGCCGCTGGTGAT
CAGTTGACCACCACTGAGTACTGGGTGCGGCAGGTCCGGGACACGGTCCGGTTCGGCGAG
CAGGTGGCCTCGTACGAGGACGCCGTGTTCGTCGAGCTGGGTGCCGACCGGTCACTGGCC
CGCCTGGTCGACGGCGTCGCGATGCTGCACGGCGACCACGAGGCGCAGGCCGCTGTCAGT
GCCCTGGCCCACCTGTACGTCAACGGCGTCACCGTCGACTGGCCCGCGCTCCTGGGCGAT
GCTCCGGCAACACGGGTGCTGGACCTTCCGACGTACGCCTTCCAGCACCAGCGCTACTGG
CTCGAGGGCACGGACCGGATGGCCGCGGGCGGCCATCCGCTGCTGGGTGAGGCGGTGGCG
GTTCCCGGCTCGGATGGTGTGCTGTTGACCGGGCGGGTGTCGTTGGCCACGCACCCGTGG
CTGGCTGATCACGCGGTGCGGGGCAGTGTGCTGCTGCCCGGTACCGGGTTTGTGGAGCTG
GTCGTCCGCGCCGCCGACGAGGTCGGTTGTGACGTCATCGACGAGCTGGTGATCGAGACG
CCGCTCCTGCTGCCGCAGACCGGAGGCGTGCAACTGTCCGTCGCGGTCGCCGAGTCCGAT
GATTCCGGACGCCGGGCGGTGACGGTCTTCTCCCGGGCGGACAACGTCGATACCTGGACG
CGGCACGCCACGGTCACGGTCAGCAACTCTGATACGACCCTCTCGCTGCCAGACCTCAGT
GCGTGGCCACCTGCCCAGGCCCAGCCGGTGAACGTGGCCGACTTCTACGATCAGTTGACC
GTGGTGGCCTACGAGTACGGTCCCGCGTTTCAGGGGCTGCAGGCCGCGTGGCGTGACGGC
GACACCGTCCACGCCGAGGTCGCCCTCGCCGAAGAGCAAGCGCAGGACGCGGCCCGAAAC
GCCGTGCATCCCGCGTTGCTGGATGCTGCCCTGCACGCCGGGATCCTGAACACGCCCGAC
ACCGAGCAGGGCGTGCGGTTGCCGTTCTCCTGGAACCAGGTTCAGGTCCACGCGGTCGGC
TCGGCGATGTTGCGCGTCGCCGTGACACAGGCGGCGGACGGCTGGAGTGTGCGGGTCGCT
GATGACACCGGCCGGCCGGTGGCCACCATCGGCTCCCTCGTGACTCGGCCGGTGACGGCC
GACACACTCGGCTCCACCACCGACGACCTGCTCGCCCTGACGTGGACGGAGATCCCGGCC
CCTCAGGAGACCAGCCTGACCATAGGCCGCTTCGAAGACCTGGCGGACGCCGATGTGCCG
GTGCCCGAGGTGGTGGTCTTCACCGCACGCCCCGACAGTAGCGAGAACCCGCTGGCCCAG
ACTCGTACGCTGACCGCCCAGGTCCTGCAGAAGATCCAGGCGTGGCTGGCCGAGGAACGC
TTCACCGACAGCACACTGATTGTGCGGATCGGCACTGGCTTGGCGGCTGCCGCGGTGTCG
GGTCTGATGCGGTCGGGCCAGTCGGAACATCCGGGCCGGTTTGTCCTGGTGGAAAGCGAC
GACGACACCCTCGCCCCCGACCAGCTGGCGGCGACCGTCGAATTGGATGAGCCGCGGCTG
CGGATCAGCGACGGCCGGTTCGAAGTGCCACGACTGACCCGTACGCATGCCGCTGAACCC
GAGTCAGAAAAGGTGTGGGATCCGGATGGCACGGTCCTGATCACCGGTGGTTCGGGTGTG
CTGGCGGGGATCGCCGCCCGGCACTTGGTGGCCGAGCGTGGCGTGCGTCATCTGCTGCTG
CTGTCCCGCAGCGCACCGGACGGGGCACTGATCAGCGAGCTTGGCGAACTGGGCGCCCAG
GTGGCCACAGCGGTTTGCGACGTATCGGATCGCCCTGGGTTGGTGCGGGTGCTGGCGGAC
GTGTCACCGGAGCATCCCCTGACGGCGGTGATTCATACCGCGGGTGTGGTGGACGACGGT
GTGGTGGAGTCCCTGACCGCGCAGCGACTGGACACGGTACTGCGGCCCAAGGCCGACGGT
GCCTGGCACCTGCACGAGCTCACCCGTGACGCCGACCTGGCCGCGTTCGTCATGTACTCC
TCGGCCGCCGGTGTATTCGGTAGCGCGGGGCAAGGCAACTATGCGGTGGCGAACGCGTTC
CTGGACGCTCTCGCAGAGCAACGTCGTGCCGAGGGCCTGCCCGCACTCGCACTCGCCTGG
GGCCTCTGGGAGGGCACCAGCGGCCTGACCGCCAATCTGACCGATACAGACCATGACCGG
ATCCGGCGCAGCGGCATGCGGGCCATCTCCGCCGAGCATGGAATGCGGCTGTTCGACGGC
GCGTCACGCCGCAGGGACCCGGTTCTGGTGGCCGCGGCGATGGAGCCGGTACGGGAAGCC
GAAGTCCCCGCGATGCTCCGGTCGTTGCACCGCCCGGTCGCCCGGCGGGCGGCCTCCGGC
GGTGCGGTGCGGTGCCTGGCCGCTCTGGCGCCGGAGGAGCGGGCGAAGGCACTGGTGAAG
GTGGTGTGTGACAGTGCCGCGACGGTTCTGGGACACGCCGACGTCGACAGTATTCCGGTG
ACCGCCGCGTTCAGGGATCTGGGCGTGGATTCGCTGACGGCGGTGGAACTACGGAACAGC
CTGACGAAGGCCACGGGACTGCGGCTGCCCGCCACGTTGGTGTTCGACTACCCGACCCCA
GGTGCCCTGGCCGCCCGGTTGGAGGAGCTGTTCACCGGCGAGAATCCTGTTCAGGTACGC
ACGCCGGTGTCGGCGGTGGGGCAGGACGAGCCGTTGGCGATCGTGGGCATGGCCTGCCGC
CTGCCTGGTGGGGTGTCGTCGCCTGAGGATCTGTGGCGCCTTGTGGAATCGGGTACGGAT
GCGATTTCCGGTTTCCCCACCGACCGTGGCTGGGACGTGGAGAACCTGTTCGACTCGGAT
CCGGATGCGGCCGGGAAGTCGTACTGCGTAGAGGGTGGCTTCCTGGCGACCGCTGCCAAC
TTCGATGCCTCGTTCTTCGGGATCAGTCCGCGTGAGGCGTTGGCGATGGATCCGCAGCAG
CGGCTGGTGCTGGAGGTGTCCTGGGAGGCGTTCGAGCGGGCTGGGATCGAGCCCGGTTCC
GTACGCGGCAGCGACACCGGCGTCTTCATGGGCGCTTTCCCGGGCGGTTACGGCATCGGC
GCAGACCTCGAAGGTTATGGTGCGACCGCTGGCCTCAACGTGCTGTCCGGCCGGCTGTCG
TACTTCTTCGGTCTTGAGGGGCCGGCCGTCACGGTGGACACGGCGTGTTCCTCGTCGCTG
GTCGCCCTGCACCAAGCGGGGTATGCCCTGCGACAGGGTGAGTGCTCGCTGGCCCTGATC
GGCGGTGTGACCGTGATGGCCACACCACATACCTTCGTGGAGTTCTCCCGGCAGCGTGGC
CTGGCATCCGATGGCCGGTGCAAGGCGTTCGCCGACAGCGCGGACGGCACGGGATGGTCT
GAGGGAGTCGGCGTCCTGCTGGTCGAGCGCCTGTCAGACGCTCAGGCCAAGGGCCACCAG
GTATTGGCAGTGGTCCGCAGCTCGGCGGTCAACCAGGACGGCGCGTCGAACGGCCTGTCC
GCGCCGAATGGCCCCTCGCAACAGCGGGTGATCCGGCAGGCGCTGGCCAACGCGGGCCTG
ACCACGGCCGAGGTGGATGTGGTCGAGGCCCACGGCACGGGTACGACGTTGGGTGACCCG
ATCGAGGCCCAGGCGGTGATCGCGACCTACGGTCAGGATCGTGACCAGCCTGTGCTGCTG
GGTTCGGTGAAGTCGAACGTCGGTCATACGCAGGCTGCCGCGGGTGTGTCGGGTGTCATC
AAGATGGTGATGGCGCTGCAGCACGGTCTGGTGCCGCGTACGTTGCATGTGGATGAGCCG
TCGCGGCATGTGGACTGGACGGATGGCGCGGTTGAGCTGGTGACGGAGAACCAGTCCTGG
CCCGAAGCCGGTCGGCCGCGCCGGGCAGGCGTGTCGTCCTTCGGAGTCAGTGGCACTAAT
GCCCACGTCATCCTGGAGAGCGCACCCCCCACGCAGGCCGTGGACGATGTGCGGCCTGCG
GATGCGCCGGTGGTGGCGTCGGTGATGGCCTCGGAGTTGGTGCCGTTGGTGATTTCGGCC
AAGACGCAGTCGGCACTGGCTGAGTACGAGGGCCGGTTGCGTGCGTATCTGGCGGCGTCG
CCCGGGGTGGATATGCGGGCTGTGGCATCGACGCTGGCGATGACACGGTCGGTGTTCGAG
CACCGTGCGGTGATCGTGGGTGATGACACTGTTAGTGGGACCGCGGCGACCGATCCGCGG
GTGGTGTTCGTCTTCCCGGGGCAGGGGTCGCAGCGTGCTGGTATGGGTGCGGAACTGGCC
GCCGCGTTCCCCGTCTTCGCGCGGATCCATCAGCAGGTGTGGGACCTGCTCGATGTGCCC
GATCTGGAGGTGAATGAGACCGGTTACGCCCAGCCGGCTTTGTTCGCTTTGCAGGTGGCT
CTGTTCGGGTTGCTGGAATCGTGGGGTGTACGGCCGGACGCGGTGATCGGCCATTCGGTG
GGTGAGCTTGCGGCTGCGTACGTGTCCGGGTTGTGGTCGTTGGAGGATGCCTGCACTTTG
GTGTCGGCGCGGGCTCGTCTGATGCAGGCTCTGCCTGCGGGTGGGGTGATGGTCGCTGTC
CCGGTCTCGGAGGATGAGGCTCGGGCCGTGCTGGGTGAGGGTGTGGAGATCGCCGCGGTC
AACGGCCCGTCGTCGGTGGTTCTCTCCGGTGATGAGGCCGCTGTGCTGCAGGCCGCGGAG
GGGCTGGGGAAGTGGACGCGGCTGGCGACCAGTCACGCGTTCCATTCCGCCCGTATGGAG
CCGATGCTGGAGGAGTTCCGGGCGGTCGCTCAAGGCCTGACCTATCACGCACCTGGTGTC
GTGATGGCCGCTGGTGATCGGGTGATGACGGCTGAGTATTGGGTGCGGCAGGTCCGGGAT
ACGGTCCGGTTCGGCGAGCAGGTGGCCTCATACGAGGACGCCGTGTTCGTCGAGCTGGGT
GCCGACCGGTCACTGGCCCGCCTGGTCGACGGCGTCGCGATGCTGCACGGCGACCACGAA
ACCCAGGCCGCGATCGGCGCCCTGGCCCACCTGTATGTCAACGGCGTCACCGTCGACTGG
ACCGCGCTGCTGGGTGATGTCCCGGTAACCCGGGTGCTGGATCTTCCGACGTACGCCTTC
CAGCAGCAGCGGTATTGGGCTGAGGTCGGCCGGTCTGCCGATGTGTCGGGGGCGGGTCTG
GATGCGGTGGGGCATCCGTTGCTGGGTGCGGTGGTGGCGTTGCCGGGTTCGGATGGTGTG
CTGTTGACCGGGCGGGTGTCGTTGGCCACGCATGCGTGGCTGGCTGATCACGCGGTGCGG
GGCAGTGTGCTGCTGCCCGGTACCGGGTTTGTGGAGCTGGTTGTCCGCGCGGCTGATGAG
GTGGGCTGCGACGTCGTTGACGAGCTGATCGTCGAAGCCCCGCTTCTGCTGCCGCAGACC
GGCGGTGTGCAGGTGTCGGTATCGGTTGGTGAGGCTGACGAGTCCGGACACCGGGTGGTG
ACGATCTTCTCCCGGGCGGACAACGCCGATACCTGGGTCCGGCACGTTTCCGCCGTGATC
AGTACCTCTGACTCGACGGTCTCGCTGTCGGAGTTTGCCTCGTGGCCACCAGCTCAGGCA
CAGCCGGTGGACGTGACGGGCTTCTACGACCCGCTGATGGCAGAAGGGTACGAGTACGGT
CCCGCGTTCCAGGGTTTGCAGGCCGCGTGGCGTTATGGGGACACTGTCTTCGCCGAGGTT
GCTCTGGCTGAGGAGCAGGTCCGGGAGGCGGCGCGATATCCCTCCGTGCATCCGGCTCTA
CTGGATGCGGCTCTGCATGCCTGCACCCTTGAATGCGCCGATGCCGAGGTGGGTGTGGGG
CTGCCGTTCTCCTGGGACGGTGTTCGGGTCCATGCTGGTGGTTCGGCCATGTTGCGTGTC
GCGGTGACGCAGGCGGCGGATGGCTGGAGTGTGCGGGTCGCTGATGAGATCGGTCGGCCG
GTGGCTAACGTGGGTTCGCTCGTGACGCGCCCGGTGACGGCCGACGCGCTCGGTTCCGCT
GCCGATGACCTGCTCGCCTTGACCTGGGCGGAGATCCCGGCCCCTGAGGGGACCGGACTG
ACGGTCGGCCGGTTCGAGGAGCTGGTGTCGGACGGCGATGTGCCGGTACCCGAGGTGGCG
GTCTTCACCGCACTCCCCGACAACGACGACGACCCGCTGGAGCAAACACGAAAGCTGACC
GGTCAGGTCCTCCAGGCAGTTCAGGAGTGGCTTGGCGGGGAGCGCTTCAGCGACAGCACG
CTGGTGGTGCGGACCGGTACTGGTTTGGCCGCTGCTGGGGTGTCGGGGTTGATGCGGTCG
GCCCAGTCCGAACACCCCGGCCGGTTCGTCCTGGTCGAGAGTGATGACGATGCCCTCGCT
CTGGATCAGTTGGCGGCGGCGGTCGGGTTGGATGAGCCGCGCCTGCGGATCAGCGACGGC
CGCTTCGAAGCGCCACGACTGACCCGTACGCATGCCGCTGAACCCGAGTCAGAGAAGGTG
TGGGATCCGGATGGCACGGTTCTGATCACCGGTGGTTCGGGTGTGCTGGCGGGGATCGCC
GTCCGGCACCTGGTGACCGAACGCGGCGTGCGTCATCTCCTTCTGCTGTCCCGCAGCGCC
CCGGACGAGGCACTGATCAACCAACTCGGCGAACTGGGGGCCCGGGTCGAGACAGCGGCC
TGTGACGTGTCCGATCGTGCCGCGCTGGCCCAGGTGCTGGCGGGTGTGTCACCGGAGCAT
CCCCTGACGGCCGTGATTCACACCGCGGGCGTACTCGATGACGGTGTGGTGGAGTCCCTG
ACCGCGCAGCGGCTGGACGCGGTGTTGCGGCCCAAGGCCGACGGTGCGTGGAACCTGCAC
GAGCTCACCCGGGATGCCGACCTGGCGGCGTTCGTCATGTATTCCTCCGCCGCTGGTGTG
CTCGGCAGTGGGGGACAGGGCAACTACGCGGCGGCCAATGCGTTCCTGGACGCGCTGGCT
GAGCAGCGTCACGCTGAGGGTCTGCCCGCGCTGGCGGTGGCCTGGGGTCTGTGGGAGGAC
GCCAGTGGCCTGACCGCGCAACTGACCGACACGGACCGTGACCGGATCCGGCGCGGTGGC
CTGCGGGCCATCTCCGCCGAGCACGGGATGGGGCTGTTCGACAGCGCGTCACGCCACAGT
GAACCGGTTCTGGTGGCCGCGCCGATGGAGCCGGTACGGGACGCGGAAGTCCCGGCATTG
CTGCGGTCGTTGCACCGCCCGGTCGCTCGGCGGGCCGCTGCCGCCGGTGGAGCGCGGTGG
CTGGCCGCCCTGGCACCGGCCGAGCGGGAGAAGGCACTGCTGAAGCTGGTGTCTGACGGC
GCCGCGACGGTTCTGGGACACGCCGACACCAGCACGATTCCGGCAACCACGGCGTTCAAG
GATCTGGGCATCGATTCGCTGACCGCGGTGGAACTGCGCAACAGCCTGGCGAAGGCCACG
GAGCTGCGGCTGCCCGCCACGCTGGTGTTCGACTACCCCACCCCGACGGCCCTGGCTGCC
CGGTTGGACGAGTTGTTCACCGGCGAGAACCCCGCTCCGGTGCGCGGGCCAGTGTCGGCG
GTGGCGCAGGACGAGCCGCTGGCGATCGTGGGAATGGCCTGCCGCCTACCCGGTGGAGTC
TCGTCGCCGGAGGATCTGTGGCGCTTGGTCGAGTCCGGTACGGACGCGATTTCCGGCTTC
CCAACCGACCGCGGCTGGGACGTCGAGAACCTGTACGATCCGGACCCGGACGCGCCCGGG
AAGTCCTACAGCGTGCAGGGCGGCTTCCTGGATGCCGCGGCCGGTTTCGACGCCTCGTTC
TTCGGGATCAGTCCGCGTGAGGCGTTGGCGATGGATCCGCAGCAGCGGTTGATGCTTGAG
GTGTCCTGGGAGGCGTTCGAGCGGGCCGGGATCGAGCCCGGTTCCGTACGCGGCAGCGAC
ACCGGCGTCTTCATAGGTGCTTACCCCGGTGGCTACGGCATCGGTGCCGACCTCGGCGGC
TTCGGGACAACTGCTGGTGCGGCGAGTGTGTTGTCGGGCCGGGTGTCGTACTTCTTCGGT
CTCGAAGGTCCCGCGTTCACGGTGGACACGGCGTGTTCGTCGTCGCTGGTGGCGTTGCAT
CAGGCGGGGTATGCCCTGCGACAGGGTGAGTGTTCGCTGGCCCTGGTCGGCGGCGTGACC
GTGATGCCCACGCCGCAGACTTTCGTGGAGTTCTCGCGGCAGCGAGGCTTGTCAGCCGAT
GGCCGGTGCAAGGCGTTCGCTGACGCCGCGGACGGCACGGGGTGGGCTGAGGGCGTCGGC
GTCCTATTGGTGGAGCGTTTGTCGGATGCTCAGGCCAACGGTCACCAGATATTGGCGGTG
GTCCGTAGCTCGGCGGTGAACCAGGACGGTGCGTCGAACGGCCTGTCCGCGCCGAACGGT
CCTTCGCAGCAGCGGGTGATCCGGGCCGCTCTCAGCAACGCCGGCCTGGCGCCGCACGAG
GTGGATGTGGTCGAGGCGCACGGCACGGGTACGACGCTGGGTGACCCGATCGAGGCCCAG
GCGGTGATCGCTACTTACGGCCAGGGCCGCGGGGAGCCGCTGCTGCTGGGATCGCTGAAG
TCGAACGTCGGCCATACCCAGGCTGCCGCAGGTGTGTCGGGTGTCATCAAGATGGTGATG
GCCCTGCAGCACAGCATGGTGCCGCGCACGTTGCATGTGGATGAGCCGTCGCGGCATGTG
GACTGGTCGGCGGGTGCGGTCGAGCTGGTGGCGGAGAACCAGCCGTGGCCGGAGACCGGC
CGACCCCGTCGGGCAGGTGTGTCGTCGTTCGGGATCAGTGGCACTAACGCCCACGTCATC
CTTGAGAGTGCACCGGCACAGTCTGTGGGCGACACGGCTGGCTCTACACCCGTACTGGTT
TCGGAACTGGTGCCGCTGGTGATATCGGCCAAGACCCAGCCCGCCCTGACCGAACACGAA
GACCGGCTCCGCGCCTACCTGGCGGCGTCGCCCGGAGTGGATATACGGGCTGTGGCATCG
ACGCTGGCGGTGACACGGTCGGTGTTCGAGCACCGCGCCGTACTCCTTGGAGATGAGACC
GTCACCGGCACCGCGGTGTCCGACCCCAGGATCGTGTTCGTCTTTCCCGGGCAGGGATGG
CAGTGGCTGGGGATGGGCAGTGCACTGCGCGATTCGTCGGTGGTGTTCGCCGAGCGGATG
GCCGAGTGCGCGGCGGCGTTGAGTGAGTTTGTGGACTGGGATCTGTTCGCCGTGCTGGAT
GATCCGGCGGTGGTGGACCGGGTTGATGTGGTCCAGCCCGCTTCCTGGGCGGTGATGGTT
TCCCTGGCCGCGGTGTGGCAGGCCGCCGGTGTGCGGCCGGATGCGGTGATCGGCCATTCG
CAGGGTGAGATCGCCGCGGCGTGTGTGGCGGGTGCGGTGTCGATGCGGGATGCCGCCCGG
ATCGTGACCTTGCGCAGCCAGGCGATCGCCCGGGGCCTGGCGGGCCGTGGTGCGATGGCA
TCCGTCGCCCTGCCCGCACAGGATGTCGAGCTGGTCGACGGGGCCTGGATCGCCGCCCAC
AACGGTCCCGCCTCCACCGTGATCGCGGGCACCCCGGAAGCGGTCGACCATGTCCTCACC
GCTCTGAGGCAAAGGGGTGCGGGTGCGGCGGATCACGTCGACTACGCCTCGCACACCCCG
CACGTCGAGCTGATCCGCGACGAACTGCTCGACATCACTAGCGACAGCAGCTCGCAGGAC
CCGCTCGTGCCGTGGCTGTCGACCGTGGACGGCACCTGGGTCGACAGCCCGCTGGACGGG
GAGTACTGGTACCGGAACCTGCGTGAGCCGGTCGGTTTCCACCCCGCCGTCAGCCAGTTG
CAGGCCCAGGGCGACACCGTCTTCGTCGAGGTCAGCGCCAGCCCGGTGCTGATGCAGGCG
ATGGACGACGATGTCGTCACGGTTGCCACGCTGCGTCGTGACGACGGGGACGCCACCCGG
ATGCTCACCGCCCTGGCACAGGCCTATGTCCACGGCGTGACTGTCGACTGGCGCGCGGTG
CTGGGTGATGTCCCGGCAACACGGGTGCTGGATCTTCCGACGTACGCGTTCCAGCACCAG
CGGTATTGGGCTGAGGCCGGCCGGTCTGCCGATGTGTCGGCGGCGGGTCTGGATGCGGTG
GGCCACCCGTTGCTGGGTGCGGTGCTGGCGATGCCGGGTTCGGATGGTGTGATGCTGACC
GGGCGGGTATCACTGGCCACCCACGCGTGGCTGGCTGATCACGCGGTCCGGGGCAGTGTC
CTGCTGCCCGGTACCGGGTTTGTGGAGCTGGTTGTCCGCGCGGCTGATGAGGTGGCCTGC
GACGTCGTTGACGAGCTGATCGTCGAAGCCCCGCTTCTGCTGCCGCAGACCGGCGGTGTG
CAACTGTCCGTATCCGTCGGCGAGGCCGACGAGTCCGGACACCGCGCGGTGACGGTCTTC
TCCCGGGCGGACAGCGCCGATGCCTGGGTCCGGCACGTTTCCGCCACCGTCAGCGTGTCC
GACACGACTGTGCCAACGTCGGACCTCACCGCGTGGCCACCTGCGCAGGCCAAGCCGGTG
GACGTGGCAGGCTTCTACGACCAGCTGACCAGGGCGGGTTACGAGTACGGACCTGCCTTC
CAGGGTTTGCAGGCCGCGTGGCGTGATGGTGACACCGTCTTCGCCGAGGTTGCTCTGGCT
GAGGAGCAGACCCAGGACGCGGCACGATTCGCCGTCCACCCTGCGGTGTTGGATGCCGCC
CTGCACGCCGGGATCCTGAACACACCCGATGCCGACCGCGACACCGTGCGGTTGCCGTTC
TCCTGGAACCACGTCCAGGTCCATGTCACTGGCTCGGCCACGCTGCGGGTCGCGATGACA
CGGGTCGCGGATGGCTGGGGTGTGCGGGTCGCTGATGACATCGGTCGGCCGGTGGCCACC
ATCGGCTCGCTGGTGACCCGTCCGGTGGCAGCCGATGCGCTCGGTTCTGCTGTCGATGAT
CTGTTCGCCCTGACGTGGACGGAGATCCCGGTCTCCCAGCAGGTCGGCGTGACGGTGGGC
AAGTTTGAAGACCTCGCGGACGGCGAGGTGCCGATGCCCGATGTCGTTGTGTTCACCGCA
CTCCCCGACAGCGGTGACCCGCTGGCACAGACTCGTCGGCTGACCGCTGAGGTTCTGCAG
GCGGTGCAGGTGTGGCTGGCGGGGGAGCGTTTCACTGACAGTACGCTGGTTGTGCGGACC
GGAACTGGTTTGGCCGCAGCCGCGGTGTCGGGGTTGATGCGTTCGGCTCAGTCGGAGCAC
CCGGGCCGGTTCGTCCTGGTGGAAAGTGACGACGACACCCTCACCCCGGACCAACTGGCC
GCCACCGTCGGGCTCGATGAGCCGCGGCTGCGGGTCATCGACGGCCGGTACGAGGCACCG
CGACTGACTCGTACGGGCGTCGCTGAGCCTGAGCCTGAAGGCGTCTGGGATCCGGATGGC
ACGGTTCTGATCACCGGTGGTTCGGGTGTGCTGGCGGGGATCGCCGCCCGGCACCTGGTG
GCCGAACGCGGTGTGCGTCATCTGCTGTTGCTGTCCCGCAGCGCCCCGGACGAGGCGCTG
ATCAGCGAGCTGGCCGAGTTGGGTGCCGCGGTGGTGGACACGGCGGTGTGCGACGTGTCG
GACCGTGCCGGGCTGGCGCGGGTGCTGGCGGGTGTGTCGCCGGACCATCCATTGACGGCG
GTGATTCACACCGCAGGTGTGCTGGATGACGGCGTCGTGGAATCGTTGACGGCGCGGCGG
CTGGACACCGTGCTGCGGCCCAAGGCGGATGGTGCGTGGAACCTGCACGAGCTCACCCGC
GATATCGACCTTGCCGCGTTCGTCATGTACTCCTCGGCTGCCGGTGTGCTCGGTAGTGCG
GGGCAGGGTAACTACGCGGTGGCGAACGCGTTCGTGGACGCGCTGGCTGAGCAGCGTCGT
GCTGAGGGTCTGCCGGCCCTCGCGCTGGCCTGGGGCCTGTGGGAGGACGCCAGCGGCCTG
ACCGCGAAGCTGACCGGTACCGACCATGACCGGATCCGGCGCAGCGGGCTGCGAACCATC
ACCGCCGAGCGCGGGATGCGGCTGTTCGACATCGCCTCACGTCAGGGTGAACCGGTTCTG
GTGGCCACGCCGATGGAGCCGGTGCGGGAGGTCGAGGTTCCGGCATTGCTGCGTTTGTTG
CACCGCCCGGTTGCCCGGCGGGCCGCCTCCACCGGTGATTCGTCGGCGCAGTGGCTGGTC
GGCTTGGCGCCGGAGGAGCGGGCGAAGGCACTGCTGAAGGTGGTGCGTGACAGCGCCGCG
ACGGTTCTGGGACATGCCGACGCCCGCAGTATTCCGGCGACCGGTGCGTTCAAGGATTTG
GGTGTGGACTCGCTGACCGCGGTGGAGCTGCGCAACAGTCTGACGAAGGCCACGGGCCTG
CGGCTGCCCGCCACAATGGTGTTCGACTACCCGACCCCGGCAGACCTGGCCGCCCGGCTG
GGCGACCTCATGAACCCGAGGGTTCAGTCGACGACCCTGCTCGCCGAGATCGATCGCATA
GAAAAGATGTTCACGTCCGTGACCTTCGACGATCGACAGGCATCCGCGATCAAGGATCGG
CTGTCGTCGGTTCTGAATAAATGGCAGCGGATTTCGAGCCCCGAAGAGGTTTCCACTACC
GCCCTCTCGAGTGCGAGTGCCAGCGAAATCCTTGACTTCATCGATCGGGAGTTCGGTGAT
CCCACGGCCTGA
[5] KS33..402
[5] AT542..780
[5] malonyl-CoA712..716
[5] dh858..1002
[5] KR1267..1443
[5] ACP1535..1605
[6] KS1626..1995
[6] AT2135..2438
[6] methylmalonyl-CoA2319..2322
[6] dh2478..2639
[6] kr2919..3095
[6] ACP3170..3244
[7] KS3266..3633
[7] AT3778..4081
[7] methylmalonyl-CoA3962..3965
[7] DH4121..4282
[7] ER4577..4882
[7] KR4892..5068
[7] ACP5158..5232
[8] KS5254..5620
[8] AT5756..5994
[8] malonyl-CoA5926..5930
[8] DH6072..6233
[8] KR6510..6686
[8] ACP6774..6848
[9] KS6870..7238
[9] AT7382..7620
[9] malonyl-CoA7552..7556
[9] DH7705..7866
[9] KR8145..8321
[9] ACP8409..8483
[10] KS8505..8874
[10] AT9012..9314
[10] methylmalonyl-CoA9195..9198
[10] DH9362..9523
[10] KR9800..9977
[10] ACP10071..10141
[5] KS97..1206
[5] AT1624..2340
[5] malonyl-CoA2134..2148
[5] dh2572..3006
[5] KR3799..4329
[5] ACP4603..4815
[6] KS4876..5985
[6] AT6403..7314
[6] methylmalonyl-CoA6955..6966
[6] dh7432..7917
[6] kr8755..9285
[6] ACP9508..9732
[7] KS9796..10899
[7] AT11332..12243
[7] methylmalonyl-CoA11884..11895
[7] DH12361..12846
[7] ER13729..14646
[7] KR14674..15204
[7] ACP15472..15696
[8] KS15760..16860
[8] AT17266..17982
[8] malonyl-CoA17776..17790
[8] DH18214..18699
[8] KR19528..20058
[8] ACP20320..20544
[9] KS20608..21714
[9] AT22144..22860
[9] malonyl-CoA22654..22668
[9] DH23113..23598
[9] KR24433..24963
[9] ACP25225..25449
[10] KS25513..26622
[10] AT27034..27942
[10] methylmalonyl-CoA27583..27594
[10] DH28084..28569
[10] KR29398..29931
[10] ACP30211..30423

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [535-651]  G3DSA:3.40.366.10 [712-795]  G3DSA:3.40.366.10 [2127-2255]  G3DSA:3.40.366.10 [2319-2428]  G3DSA:3.40.366.10 [3770-3898]  G3DSA:3.40.366.10 [3962-4071]  G3DSA:3.40.366.10 [5746-5865]  G3DSA:3.40.366.10 [5926-6007]  G3DSA:3.40.366.10 [7373-7491]  G3DSA:3.40.366.10 [7552-7632]  G3DSA:3.40.366.10 [9004-9132]  G3DSA:3.40.366.10 [9195-9304]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002364 Quinone oxidoreductase/zeta-crystallin, conserved site (Conserved_site)
 [4704-4725]  PS01162
PS01162   QOR_ZETA_CRYSTAL
IPR006162 Phosphopantetheine attachment site (PTM)
 [1563-1578]  PS00012 [3202-3217]  PS00012 [5190-5205]  PS00012 [6806-6821]  PS00012 [8441-8456]  PS00012 [10099-10114]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1538-1604]  3.1e-10 PF00550 [3178-3243]  4.1e-10 PF00550 [5166-5231]  1e-11 PF00550 [6781-6847]  2.4e-13 PF00550 [8420-8482]  8.1e-11 PF00550 [10074-10140]  1.4e-12 PF00550
PF00550   PP-binding
 [1528-1642]  2.30000440726534e-28 SSF47336 [3167-3282]  2.39999798157265e-27 SSF47336 [5155-5270]  2.70000183580794e-28 SSF47336 [6771-6886]  4.19999771339581e-30 SSF47336 [8406-8521]  5.20000089003336e-28 SSF47336 [10062-10147]  3.80000697093586e-21 SSF47336
SSF47336   ACP_like
 [1535-1605]  PS50075 [3170-3244]  PS50075 [5158-5232]  PS50075 [6774-6848]  PS50075 [8409-8483]  PS50075 [10071-10141]  PS50075
PS50075   ACP_DOMAIN
 [1533-1606]  1.29999999999998e-121 G3DSA:1.10.1200.10 [3172-3246]  1.29999999999998e-121 G3DSA:1.10.1200.10 [5160-5231]  1.29999999999998e-121 G3DSA:1.10.1200.10 [6776-6850]  1.29999999999998e-121 G3DSA:1.10.1200.10 [8411-8485]  1.29999999999998e-121 G3DSA:1.10.1200.10 [10069-10144]  1.29999999999998e-121 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR011032 GroES-like (Domain)
 [4567-4722]  2.10000267834031e-32 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [4715-4810]  9.7e-16 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [4597-4651]  7.1e-08 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [1267-1442]  1.09999999999999e-59 PF08659 [2919-3094]  2.8e-55 PF08659 [4892-5067]  3.89999999999997e-60 PF08659 [6510-6685]  4.30000000000003e-59 PF08659 [8145-8320]  1.70000000000001e-61 PF08659 [9800-9976]  2.1e-58 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [33-278]  4.30000000000003e-93 PF00109 [1626-1871]  5.90000000000008e-90 PF00109 [3266-3510]  1.60000000000002e-91 PF00109 [5254-5496]  1.29999999999998e-84 PF00109 [6870-7114]  1.9e-90 PF00109 [8505-8750]  2.99999999999998e-93 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [286-402]  7.5e-46 PF02801 [1879-1995]  1.9e-44 PF02801 [3518-3633]  2.19999999999997e-45 PF02801 [5504-5620]  3.99999999999998e-45 PF02801 [7122-7238]  3.2e-46 PF02801 [8758-8874]  6.29999999999997e-45 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [542-780]  1.9e-42 PF00698 [2135-2438]  5.00000000000001e-83 PF00698 [3778-4081]  4.89999999999996e-83 PF00698 [5756-5994]  4.80000000000003e-42 PF00698 [7382-7620]  7.89999999999997e-43 PF00698 [9012-9314]  1.10000000000001e-80 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [540-812]  2.60000517657733e-54 SSF52151 [2133-2427]  3.70001063537244e-56 SSF52151 [3776-4070]  6.79998707392899e-56 SSF52151 [5754-6026]  9.19998414420354e-54 SSF52151 [7380-7652]  2.80000504261099e-54 SSF52151 [9010-9303]  9.80000272130214e-58 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [653-711]  4.60000044330862e-12 SSF55048 [2258-2318]  9.89999630839718e-16 SSF55048 [3901-3961]  1.69999922284049e-15 SSF55048 [5867-5925]  1e-11 SSF55048 [7493-7551]  1e-11 SSF55048 [9135-9196]  1.29999924468179e-11 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [36-290]  G3DSA:3.40.47.10 [291-455]  G3DSA:3.40.47.10 [1629-1883]  G3DSA:3.40.47.10 [1885-2048]  G3DSA:3.40.47.10 [3269-3522]  G3DSA:3.40.47.10 [3523-3687]  G3DSA:3.40.47.10 [5257-5508]  G3DSA:3.40.47.10 [5510-5673]  G3DSA:3.40.47.10 [6873-7126]  G3DSA:3.40.47.10 [7128-7291]  G3DSA:3.40.47.10 [8508-8762]  G3DSA:3.40.47.10 [8764-8926]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [25-400]  2.99998750445706e-102 SSF53901 [1618-1993]  1.09999184471405e-96 SSF53901 [3258-3632]  8.29994113369276e-102 SSF53901 [5246-5618]  2.7000136937899e-96 SSF53901 [6862-7236]  3.60002015031011e-98 SSF53901 [8497-8872]  1.69998802370953e-100 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1267-1449]  G3DSA:3.40.50.720 [2920-3099]  G3DSA:3.40.50.720 [4712-4807]  1.69999999999999e-18 G3DSA:3.40.50.720 [4891-5074]  G3DSA:3.40.50.720 [6510-6692]  G3DSA:3.40.50.720 [8145-8327]  G3DSA:3.40.50.720 [9800-9983]  G3DSA:3.40.50.720 [10186-10209]  G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [191-207]  PS00606 [1784-1800]  PS00606 [3423-3439]  PS00606 [5409-5425]  PS00606 [7027-7043]  PS00606 [8663-8679]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [544-810]  1e-89 SM00827 [2137-2419]  9.90001804798383e-94 SM00827 [3780-4062]  7.0999832511256e-93 SM00827 [5758-6024]  1.3000049540733e-89 SM00827 [7384-7650]  3.89999861795218e-91 SM00827 [9014-9295]  8.99992502689852e-89 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1536-1608]  7.00000734129907e-29 SM00823 [3175-3247]  3.00000067992871e-29 SM00823 [5163-5235]  1.10000150671642e-30 SM00823 [6779-6851]  1.70000295590054e-31 SM00823 [8414-8486]  4.80000830876748e-30 SM00823 [10072-10144]  1.60000240695997e-29 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [858-1002]  1.90000694315261e-47 SM00826 [2478-2639]  1e-77 SM00826 [4121-4282]  1.09999184471405e-81 SM00826 [6072-6233]  4.40002866058555e-80 SM00826 [7705-7866]  1e-80 SM00826 [9362-9523]  9.20006495413779e-82 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [35-454]  SM00825 [1628-2047]  SM00825 [3268-3686]  SM00825 [5256-5672]  SM00825 [6872-7290]  SM00825 [8507-8926]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1267-1443]  1.3000049540733e-57 SM00822 [2919-3095]  1.90000694315261e-47 SM00822 [4892-5068]  6.60002751141562e-56 SM00822 [6510-6686]  3.99998544139406e-58 SM00822 [8145-8321]  3.10001307370206e-58 SM00822 [9800-9977]  3.49999466863949e-55 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [4577-4882]  SM00829
SM00829   PKS_ER
SignalP No significant hit
TMHMM No significant hit