close all open/close all

CDS information : Rapam_00120


close this sectionLocation

Organism
StrainNRRL 5491
Entry nameRapamycin
Contig
Start / Stop / Direction66,933 / 41,242 / - [in whole cluster]
66,933 / 41,242 / - [in contig]
Locationcomplement(41242..66933) [in whole cluster]
complement(41242..66933) [in contig]
TypeCDS
Length25,692 bp (8,563 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase
Gene
Gene (GenBank)rapA
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[7644502] The biosynthetic gene cluster for the polyketide immunosuppressant rapamycin. (Proc Natl Acad Sci U S A. , 1995)
[8635756] Organization of the biosynthetic gene cluster for rapamycin in Streptomyces hygroscopicus: analysis of the enzymatic domains in the modular polyketide synthase. (Gene. , 1996)
[24923585] Modification of Rifamycin Polyketide Backbone Leads to Improved Drug Activity Against Rifampicin-Resistant Mycobacterium tuberculosis* (J Biol Chem. , 2014)
[27246853] Protein-Protein Interactions, Not Substrate Recognition, Dominate the Turnover of Chimeric Assembly Line Polyketide Synthases. (J Biol Chem. , 2016)
Related Reference
PmId
[11241621] Origin and True Nature of the Starter Unit for the Rapamycin Polyketide Synthase We thank Dr. Bradley S. Moore for help with the deuterium NMR experiments. This work was supported by grants from The Wellcome Trust (to J.S. and P.F.L.) and from the NIH (AI20264 to H.G.F.). (Angew Chem Int Ed Engl. , 2001)

close this sectionPKS/NRPS Module

0
1 methylmalonyl-CoA
2 malonyl-CoA
3 methylmalonyl-CoA
4 methylmalonyl-CoA
A35..438
ER684..990
kr1000..1143
PCP1217..1287
KS1308..1677
AT1817..2120
DH2160..2322
ER2616..2921
KR2931..3107
ACP3197..3271
KS3293..3659
AT3795..4034
dh4111..4258
KR4521..4697
ACP4785..4859
KS4881..5246
AT5386..5688
dh5728..5889
er6178..6483
kr6493..6668
ACP6758..6832
KS6854..7222
AT7362..7665
DH7705..7866
KR8144..8320
ACP8410..8484

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase]
MSRAELVRPIYDLLRANAERLGDKIAYVDSRLALTHAELATRTGRIAGHLVDMGVDRGDR
VAILLGNRVENIESYLAIARASAVAVPLNPDATEAEVAHFLSDSGAVAVITDSAHLDDVR
RTAPAANIVLVGEERTPPGVRSFAELATTEPLRPPRDDLGLDEPAWMLYTSGTTGTPKGV
LSTQGSGLWSAAYCDIPAWELTENDVLLWPAPLFHRLALHLCLLATTAVGATARIMNGFV
ASEVLEELTEHRCTVLVGVPTMSRYLLGAADTFEPRTSSLKMGLVAGSVAPASLIEGFED
VFGVPLLDTYGCTETSGSLTVNWLSGQRIPGSCGLPVPGLSLRFVDPISGADVADGEEGE
LWASGPSIMIGYHEQPEATAEVLSDGWYRTGDLARRSETGHVTITGRIKELIIRGGENIH
PHEIEAVALDVPGVKDAAAAGKQHPVLGEIPVLYVVPETGGVDTDMVLAVCRERLSYFKV
PEEIYRVDAIPRTASGKVKRSSLTEKPAELLAGASGGETLHRLEWIPLDPPKQASPDGRH
VVVRVDSLPSDAADLAGAVRDLAQSWLADKRRADSTLVFVTRRAVHTGPSDLPVPEHAAA
WDAIRREQTENPGVFVVIDVDFDDADPDPDDTLLRALAGLGEPQLALRDGNPLVPRLAHA
NTADSDSLTIPEDRAWLLEHSRSGTLRDLALVPADTAERPLRPGEVRIAVRAAGLNFRDV
LIALGTYPGEGLMGGEAAGVVLEVGPEVHDLTPGDRVFGLVGSAFGGVAITDRRLLGAIP
DTWSFTTAASIPIVFATAYYGLVDLSGLSAGETVLIHATAGGVGMAATQSACRHLGPRIH
ATASAAKQHILREAGLEDTRIADSRTLAFREAFLNTTDGQGVDVVLNSLSGDFVDASLDL
LPRGGRFLEMGKTDIRDADRITADRPGTTYQAFDLLDAGPDRLREIIAELLELFAQGVLR
PLPVLTWDIRKARDAFSWMSRARHTGKITFTIPRRLDPDGTVLIADGAGALTGTVARHLV
AEQGVRHLLLLSRSTPDEALINELIESGARVDTAVCDVSDRAGLVRTLAGIAPERPLTAV
IHTGGPAVAHESHQLHRLTKGLDLAAFVVFSQDAPASVDALARSRRAEGLPITAIAWGIP
EAEAVVVRGPLLGRAMASADSAHIVTRLNTVGLRALAAADTLPPLLQNLVGAHTDTTEQQ
AWSRQFLAAEAAREQALRDLVRSSVTDILGLSAADRYAPDKTSREMGIDSLTSVELRNSL
AKATGLRLPATLVFDYPTPAVLVVRLGELFTGESPAPERAVSAVGQGEPLAIVGMACRLP
GGVSSPEDLWRLVESGTDAISGFPTDRGWDVDGLFDPDPDASGKSYCVQGGFLDTAAGFD
ASFFGISPREALAMDPQQRLVLEVSWEAFERAGIEPGSVRGSDTGVFMGGFPGGYGAGAD
LEGFGATAGAASVLSGRVSYFFGLEGPAITVDTACSSSLVALHQAGYALRQGECSLALVG
GVTVMPTPQSFVEFSRQRGLSADGRCKAYADAADGTEWAEGVGVLLVERLSDAQAKGHQV
LAVVRGSAVNQDGASNGLSAPNGPSQQRVIRAALSNAGLAPHEVDVVEAHGTGTTLGDPI
EAQAVIATYGQDREQPVLLGSLKSNIGHAQAAAGVSGVIKMVMALRHGFVPRTLHVDEPS
RHVDWSAGAVELVAENRSWPATGRPRRAGVSAFGVSGTNAHVILEGAPAQSVDDAAGSTP
VVDSELVPLVVSAKSLPALAEVEGRLRAYLAASPGADVRAVGSTLAVTRSLFEHRAVLLG
DDSVTGTGTAVSDPRVVFVFPGQGWQWLGMGSALRTSSMVFAERMAECAAALSEFVDWDL
FAVLDDPAVVARVDVVQPASWAVMVSLAAVWQAAGVRPDAVVGHSQGEIAAACVAGAVSL
RDAARVVTLRSQVIARGLAGRGAMASVALPAQDVELVDGAWVAARNGPASTVVAGAPEAV
DRVLAVHEARGVRVRRIAVDYASHTPHVELIRDELLGVIAGVDSRAPVVPWLSTVDGTWV
EGPLDAEYWYRNLREPVGFEPAAGQLQAQGDTVFVEVSASPVLLQAMDDDVVTVATLRRD
DGDATRMLTALAQAYVEGVTVDWPAVLGTTAARVLDLPTYAFQHQRYWLKGVDRAAADGH
PLLGTVVALPGSDGVVLTGRVSLATHAWLADHAVRGSVLLPGTAFVELVVRAAGEVGCDV
VDELVIETPLLLPQTGGVQMSVSVAEADESGHRAVMVFSQADNTDTWTRHVTATVSTSDS
TVSQPEFAAWPPPAGAEPLDLSDFYDQLTGAGYEYGPAFQGLRTAWRDGNTVFAEVALAE
EQAQEAARFAVHPALLDAALHASNLSTLDTAEQGVRLPFSWNQVWVHATGPVMLRVAITR
TADGWSVLVADDSGRPVASVGSLVTRVVTADALGSAADELLALTWMEIPAPQGTGLTVGR
FEDLVSGGDVPVPEVVVFTALPGSSETPLDPLDPLAQTRTLTAQVLQAVQAWLAGEGFTN
STLVVRTGTGLAAAGVSGLMRSVQSEHPGRFVLVECDDDTLTPDQLAATVGLDEPRLRVC
DGRFEVPRLARANTPESSPLTIPDSRAWLLEQPRSGTLRDLALVPTDTAERPLQSGEVRV
DVRAAGLNFRDVVVALGMVDDKRLAGGEAAGVVLEVGPEVQDLAPGDRVFGLVGGGFGRS
AIADRRMLGVIPDGWSFTTAASVPVVFATAYYGLVDLAGLSAGESVLIHAAAGGVGMAAT
QIARHLGARIYATASTGKQHILREAGLEDTHIADSRTLSFQETFLNNTHGQGVDVVLNSL
SGDFVDASLDLLPRGGRFIEMGKTDIRDPHQVTADRPGTTYQAFDLMDAGPDRLREIITE
LLTLFTQGVLLPLPVQAWDIRQARDAFSWMSRARHIGKIVLTIPRRPDPDGTILITGGSG
VLAGILARHLAAEHGARHLLLLSRTTPDQALIKELAELGAHVDTATCDVSDRAGLARVLA
GVSPEHPLTAVIHTAGALDDGVVESLTTQQLDTVLRPKADGAWHLHELTQNTDLAAFVMY
SSAAGVLGSAGQGNYAAANAFVDALAEQRRGEGLPALAVAWGLWEDTSGLTAKMTDTDRD
RIRRGGLRAISAGRGMGLLDAASRHGEPVLLAASMEPVRDVEVPALLRLLHRPVARRAAS
TGDSSVQWLARLAPVEREKALLKLVCDGAATVLGHADASTIPATGAFRDLGVDSLTAVEL
RNGLAKATGLRLPATLVFDYPTPAALAARLEELFTGENPAPVRTSVSVVAQDEPLAIVGM
ACRLPGGVSSPEDLWRLLESGTDAVSGFPTDRGWDVENLFGPAVGNSYRLQGGFLDAAAG
FDASFFGISPREALAMDPQQRLVLEVSWEAFERAGIKPGSVRGTDTGVFMGAYPGGYGIG
ADLGGFGTTAGAVSVLSGRVSYFFGFEGPAFTVDTACSSSLVALHQAGYALRQGECSLAL
VGGVTVMATPQTFVEFARQGGLAGDGRSKAFADSADGAGFSEGVGVLLVERLSDARRNGH
QVLAVVRGSAVNQDGASNGLTAPNGPSQQRVIRAALSNAGLSTAEVDVVEAHGTGTTLGD
PIEAQALMATYGQDREQPLLLGSVKSNLGHTQAAAGVSGVIKMVMALQRGFVPRTLHVDE
PSRHVDWSAGAVQLVTENQPWPGTDRPRRAGVSSFGISGTNAHVILESALPTQPAGNTVV
ESAPEWVPLVISARTQSALAEYEGRLRAYLAASPGADTRAVASTLAMTRSVFEYRAVLIG
DDTVTGTAATDPRVVFVFPGQGSQRAGMGEELAAAFPVFARIHQQVWDLLDVPDLDVNET
GYAQPALFALQVALFGLLESWGVRPDAVVGHSVGELAAGYVSGLWSLEDACTLVSARARL
MQALPAGGVMAAVPVSEDEARAVLGEGVEIAAVNGPSSVVLSGDEAAVLQAAEGLGKWTR
LPTSHAFHSARMEPMLEEFRAVAEGLTYRTPQVAMAAGDQVMTAEYWVRQVRDTVRFGEQ
VASFEDAVFVELGADRSLARLVDGIAMLHGDHEAQAAVGALAHLYVNGVSVEWSAVLGDV
PVTRVLDLPTYAFQHQRYWLEGTDRATAGGHPLLGSVVRLAEASGVLFTARVSRSGDLWL
RDQTVLPATVFVEMALAAADEVGCGLVEDLSVEALLLLPDDGAVEVQTWVGEPDEGGRRR
LSVHARYGDGEPWTCLATATLATTTGVAAAAVGWQAGGVWPPAGAVPVGTSAPSLRAVWR
LGSDIFAEVALDDAHDATRFVLHPALMAAALTTVGEETPAVWQGLTLHAGNPGELRVRLT
SHDDGTLSAEATDSTGLPVLTARSLTLRTVPVYEPATSTDDLLTLTWAGIPTPQQTGLTV
GAFEDLAADGDVPVPEVAVFTALPDSDDPLEQTRKLTAQVLHTLQEWLGGERFSDSTLVV
RTGTGLAAAGVSGLMRSAQSEHPGRFVLVESDDALTQDQLAAAVGLDEPRLRVSDGRYEV
PRLTRTHAEEPEPERTWDPDGTVLITGGSGVLAGIAARHLVTERGVRHLLLLSRSAPDEA
LIGELGELGARVETAACDVSDPAALTQVLAGVSPEHPLTAVIHTAGVVDDGVVESLTVQR
LETVLRPKADGAWNLHELTRDADLAAFVMYSSAAGVLGSAGQANYAAANAFLDALAEQRH
AEGLPALAVAWGLWEDASGLTAQLTDTDRDRIRRGGLRAISAEHGMGLFDSASRHSEPVL
VAAPMEPVRDAEVPALLRSLHRPIARRAAAAGGARWLAALAPAEREKALLKLVCDSAATV
LGHADTSTVSVAAVFRDLGVDSLTAVELRNSLAKATGLRLPATLVFDYPTPTALAVRLGE
LFTGENPVPVRGPVSAVAQDEPLAIVGMACRLPGGVSSPEDLWRLLESGTDAVSGFPTDR
GWDVENLYDMAGKSHRAEGGFLDAAAGFDAGFFGISPREALAMDPQQRLVLEVSWEAFER
AGIEPGSVRGSDTGVFMGAYPGGYGAGADLGGFAATASATSVLSGRVSYFFGLEGPAFTV
DTACSSSLVALHQAGYALRQGECSLALVGGVTVMATPELFTEFSRQRGLASDGRCKAFAD
SADGTGWAEGVGVLLVERLSDAQAKGHQVLAVVRSSAVNQDGASNGLTAPNGPSQQRVIQ
AALSNAGLAAHEVDVVEAHGTGTTLGDPIEAQAVIATYGQDRERPLLLGSLKSNIGHAQA
ASGVSVVIKMVMALQHNTVPRTLHVDEPSRHVDWAAGAVELVRENQPWPGTDRPRRAGVS
SFGVSGTNAHVILESAPPAQPAEEAQPVETPVVASDVLPLVISAKTQPALTEHEDRLRAY
LAASPGADTRAVASTLAVTRSVFEHRAVLLGDDTVTGTAVSDPRVVFVFPGQGWQWLGMG
SALRDSSVVFAERMAECAAALSEFVDWDLTVLDDPAVVDRVDVVQPASWAVMVSLAAVWQ
AAGVRPDAVIGHSQGEIAAACVAGAVSLRDAARIVTLRSQAIARGLAGRGAMASVALPAQ
DVELVDGAWIAAHNGPASTVIAGTPEAVDHVLTAHEARGVRVRRITVDYASHTPHVELIR
DELLDITSDSSSQAPLVPWLSTVDGSWVDSPLDGEYWYRNLREPVGFHPAVGQLQAQGDT
VFVEVSASPVLLQAMDDDVVTVATLRRDDGDATRMLTALAQAYVHGVTVDWPAILGTTTT
RVLDLPTYAFQHQRYWVEGVDRSAAGGHPLLGVAVELPDSNGVVLTGRVSLATHTWLADH
AVRGSVLLPGTAFVELVVRAADEVECDVIDELVIETPLLLPQTGGVQLSVSVAEADESGH
RAVTVFSRADNADTWTRHVSATISASDAPLSLPEFASWPPAQAQPTNVGDLYDRLAAAGT
EYGPAFQGLQAAWRDGDTAYAEVALAEEQAQEAARFAVHPALLDAALHASVLHTPDAEQQ
SLRMPFSWSHVQVHATGSATLRVAMTPTTDGWSVHVADDDGRPVATIGSFVTRPVTADAL
GSAADDLLRVVWTEIPIPQQTGLTTGRFEDLVDADVPVPEVVVYTARPDTDGSPDPLAQT
RTLTAQVLQAVQAWLAGERFTDSTLVVRTGTGLAAAAVSGLMRSVQSEHPGRFVLVEGDD
DTLTPDQLAATAGLDEPRLRVCDGRFEVPRLARANTPESSPLTIPDDRAWLLEQPRSGTL
QDLALVPTDTAERPLRPGEVRIDVRAAGLNFRDVLIALGTYPGEAVIGAEAAGVVLEVGP
EAHDLAPGDRVFGLVGGGFGAVAIADRRMLAVIPDGWSFTTAASVPVVFATAYYGLVDLG
GLSAGESVLIHAAAGGVGMAATQIARHLGAQIYATASAGKQHILYEAGLDGTRIADSRTT
GFREAFLNTTDGRGVDVVLNSLSGDFVDASLDLLPRGGRFVEIGKTDIRDPHRITADRPG
TTYQACDLMDVGPDRLREIITEILSLFGQGVLQPLPVQTWDIRQARDAFSWMSRARHIGK
IVLTIPRRPDPDGTILITGGSGVLAGILARHLAAEHGARHLLLLSRTAPDEALIKELAEL
GARVETAACDVSDRAGLARVLAGVSPEHPLTAVIHTAGALDDGVVESLTTQQLDTVLRPK
ADGAWHLHELTRDADLAAFVVYSSAAAVLGNEGQGNYAAANAFLDALAEQRRTQGLPALA
LAWGPWEYTGDLTAQLTGTDQDRIRCSGMRTITAEDGMRLFDTASHHGEPLLVPAVLDPT
RDGEVPALLRSLRRPIARRAASADGGVQWLAALAPAEREKALLKLVCDSAAMVLGHADAR
SIPAAGAFKDLGVDSLMAVELRNGLVKATGLRLPATLVFDYPTPTVLAARLDELFTGENP
APVRGPVSVVGQDEPLAIVGMACRLPGGVSSPEDLWRLVESGTDAVSGFPTDRGWDVENL
YDSDPEAAGKSYCVQGGFLDTAAGFDAGFFGISPREALAMDPQQRLLLEVSWEAFERAGI
EPGSVRGSDTGVFIGAFPVGYGAGFDREGYGATSGPSVLSGRVSYVFGLEGPAITMDTAC
SSSLVALHLAAQALRNGECSMALAGGVTVMATPEVFTEFARQRGLASDGRCKAFADSADG
AGFSEGAGLLLVERLSDARRNGHQVLAVVRGSAVNQDGASNGLTAPNGPSQQRVIRAALS
NAGLSTADVDVVEAHGTGTTLGDPIEAQALLATYGQDREQPLLLGSLKSNIGHTQAASGV
SGVIKMVMALRHGFVPRTLHVDEPSRHVDWAAGAVELVRENQPWPGTDRPRRAGVSSFGV
SGTNAHVVLESAPPAQPAEEEQPVETPVVASDVLPLVISAKTQPALTEHEDRLRAYLAAS
PGADTRAVASTLAVTRSVFEHRAVLLGDDAVTGTAVTDPRVVFVFPGQGWQWLGMGSALR
DSSVVFAERMAECAAALSEFVDWDLFAVLDDPAVVDRVDVVQPASWAVMVSLAAVWQAAG
VRPDAVIGHSQGEIAAACVAGAVSLRDAARIVTLRSQAIARGLAGRAAMASVALPAHEIE
LVDGAWIAAHNGPASTVIAGTPEAVDHVLTAHEARGVRVRRITVDYASHTPHVELIRDEL
LGITAGIGSQPPVVPWLSTVDGSWVDSPLDGEYWYRNLREPVGFHPAVSQLQAQGDAVFV
EVSASPVLLQAMDDDVVTVATLRRDDGDATRMLTALAQAYVHGVTVDWPAILGTTTARVL
DLPTYAFQHQRYWVKSVDRAAADGHPLLGAVVELPESDGVLLTGRVSLATHAWLADHAVW
GRVLLPGTAFVELVVHAAGEVGCDVVDELVIETPLLLPQTGGVQLSVSVGEADESGHRVV
TVFSRADNADTWTRHVSATVRVSDTTVPPSDLTAWPPAQAKPVDVAGFYDQLTGMGYEYG
PAFQGLQAAWRDGDTVFAEVALAEEQVREAARYAVHPALLDAALHACTLNASDAEVGVGL
PFSWNGVRVHAGGSAMLRVAVTQAADGWSVRVADDIGRPVASVGSLVTRPVTADALGSAA
DDLLALTWAGIPTPQQTGLTVGRFEELVSDGDVPVPEVAVFTALPDNDDDPLEQTRKLTG
QVLQAVQEWLGGERFSDSTLVVRTGTGLAAAAVSGWMRSAQSEHPGRFVLVESDDDALAP
DQLAAAVGLDEPRLRISDGRFEAPRLTRTHAAEPESEKVWDPDGTVLITGGSGVLAGIAA
RHLVAERGVRHLLLLSRSAPDEALINQLGELGARVETAACDVSDRAALAQVLAGVSPEHP
LTAVIHTAGALDDGVVESLTAQRLDAVLRPKADGAWNLHELTRDADLAAFVMYSSAAGVL
GSAGQANYAAANAFVDALAEQRRAEGLPALAVAWGLWEDASGLTADLTDTDRDRIRRGGL
RAISAEYGMGLFDSASRHSEPVLVGAAMEPVRDAEVPALLRSLHRPIARRAASTGDSSVQ
WLAALAPEERAKALLRVVCDSAATVLGHADIDSIPVTAAFKDLGVDSLTAVDLRNSLAKA
TGLRLPPTLVFDYPTPTALAARLDELFAPAEPEPRLHEQELRRALAGISIDKFREAGVLD
TLLRLAAMEGLAVPKPDSESDDEAFVDEMDADALIKHVLEEER
selected fasta
>polyketide synthase [polyketide synthase]
ATGTCACGCGCGGAACTGGTACGGCCTATTTATGATCTGCTTCGCGCGAATGCTGAACGG
CTCGGCGACAAAATAGCGTACGTGGACTCGCGGCTCGCACTGACGCATGCCGAACTGGCC
ACGCGGACCGGACGGATCGCCGGGCACCTGGTGGACATGGGTGTGGACCGGGGCGACCGG
GTCGCGATCCTGCTGGGGAACCGCGTCGAGAACATCGAAAGCTATCTGGCGATCGCCCGG
GCCAGCGCGGTTGCCGTACCGCTCAACCCGGACGCGACCGAGGCCGAGGTCGCCCACTTC
CTGTCGGACAGCGGCGCCGTAGCCGTCATCACCGACTCCGCTCATCTCGACGATGTGCGT
CGCACGGCCCCCGCAGCGAACATCGTTCTGGTGGGCGAGGAACGAACTCCCCCAGGAGTA
CGGTCATTCGCCGAGCTGGCCACCACCGAGCCCCTCCGGCCGCCACGCGACGACCTGGGG
CTCGATGAACCAGCCTGGATGCTCTACACCTCCGGCACCACGGGCACCCCGAAGGGCGTC
CTGTCGACCCAGGGCAGCGGCCTCTGGTCCGCGGCGTATTGCGATATCCCCGCCTGGGAG
CTGACCGAGAACGACGTTCTGCTCTGGCCCGCGCCGCTGTTCCACAGACTCGCCCTCCAC
CTGTGTCTCTTGGCCACCACCGCCGTCGGCGCCACTGCGCGGATCATGAACGGCTTTGTG
GCGAGCGAGGTGCTCGAAGAGCTCACGGAGCATCGGTGCACCGTGCTCGTCGGCGTGCCG
ACGATGTCCCGCTATCTCCTGGGAGCCGCCGACACGTTCGAACCACGGACGTCGTCGCTG
AAAATGGGCCTGGTCGCCGGCTCCGTCGCGCCGGCTTCCCTCATCGAGGGCTTCGAGGAC
GTCTTCGGCGTACCGCTGCTCGACACCTACGGCTGCACCGAGACCAGCGGATCCCTCACC
GTCAACTGGCTCAGCGGCCAACGGATCCCCGGTTCGTGCGGCCTCCCCGTCCCGGGGCTG
TCCCTGCGCTTCGTCGATCCCATCAGCGGCGCCGACGTCGCGGACGGCGAAGAGGGCGAA
CTGTGGGCCAGCGGACCGAGCATCATGATCGGCTACCACGAGCAGCCCGAAGCCACGGCA
GAGGTGCTTTCGGACGGGTGGTACCGCACCGGTGACCTGGCCCGCCGCAGCGAGACGGGA
CACGTCACCATCACCGGCCGGATCAAGGAACTCATCATCCGCGGTGGTGAGAACATCCAC
CCGCACGAGATCGAGGCAGTGGCGCTCGACGTGCCCGGGGTCAAGGATGCGGCAGCGGCA
GGCAAGCAGCACCCCGTACTCGGCGAGATTCCCGTGCTGTACGTCGTGCCGGAAACGGGC
GGTGTCGACACTGACATGGTGCTCGCCGTGTGCCGCGAACGGTTGTCGTACTTCAAGGTG
CCAGAGGAGATCTACCGGGTCGACGCCATCCCGCGGACCGCGTCCGGCAAGGTGAAGCGC
TCCTCCCTCACGGAGAAACCGGCCGAATTGCTCGCCGGAGCGAGCGGCGGCGAAACCCTG
CACCGGCTGGAGTGGATTCCCCTCGACCCGCCGAAACAGGCCTCCCCGGACGGCCGCCAT
GTGGTCGTACGCGTCGACTCCCTGCCGTCCGACGCCGCCGACCTGGCCGGCGCGGTCCGC
GATCTCGCGCAGTCCTGGCTCGCCGACAAGCGGCGTGCCGATTCGACACTCGTCTTCGTC
ACCCGCCGTGCCGTGCACACTGGTCCCTCCGACCTCCCGGTCCCCGAGCACGCAGCGGCG
TGGGACGCGATCCGCCGGGAACAGACGGAGAACCCCGGCGTCTTCGTCGTCATCGACGTC
GACTTCGACGATGCCGACCCCGACCCCGACGACACCCTCCTGCGGGCCCTCGCCGGGCTC
GGAGAACCACAGCTCGCGCTGCGCGACGGTAATCCGCTCGTCCCGCGACTGGCCCACGCG
AACACCGCGGACAGCGACTCGCTCACGATCCCCGAGGACCGTGCGTGGCTGCTGGAGCAC
TCCCGCAGCGGAACCCTGCGAGACCTCGCCCTGGTACCCGCCGATACCGCTGAGCGGCCC
TTGCGCCCCGGCGAGGTGCGGATAGCCGTGCGCGCCGCGGGTCTGAACTTCCGGGATGTT
CTCATCGCTCTGGGCACGTACCCAGGTGAGGGACTGATGGGAGGTGAGGCCGCGGGCGTG
GTGCTCGAGGTCGGCCCGGAAGTACACGACCTGACCCCGGGAGACCGGGTCTTCGGGCTC
GTGGGAAGTGCGTTCGGGGGGGTCGCGATCACCGATCGCCGTCTGCTCGGTGCGATACCC
GATACGTGGTCCTTCACGACGGCGGCGTCCATCCCCATCGTGTTCGCCACCGCCTACTAT
GGGCTCGTGGACCTGTCCGGGTTGAGTGCGGGTGAGACCGTGCTGATCCACGCCACGGCG
GGTGGCGTGGGCATGGCAGCGACCCAGAGTGCTTGCCGCCACCTCGGCCCGCGGATCCAC
GCGACCGCCAGCGCGGCCAAGCAGCACATCCTGCGTGAGGCGGGCCTGGAGGACACCCGG
ATCGCGGACTCCCGCACACTCGCATTCCGGGAAGCGTTCCTGAACACCACCGACGGCCAG
GGTGTCGACGTCGTCCTCAACTCTCTCAGCGGTGACTTCGTCGATGCTTCGCTCGACCTG
CTGCCCCGCGGTGGCCGGTTCCTGGAAATGGGCAAGACCGACATCCGCGACGCGGACCGG
ATCACCGCGGACCGGCCTGGTACCACCTATCAAGCGTTCGACCTCCTGGACGCCGGCCCG
GACCGGCTGCGGGAAATCATCGCCGAGCTGCTCGAACTGTTCGCACAGGGCGTGCTGCGG
CCGCTGCCCGTACTGACCTGGGATATCCGCAAGGCCCGCGACGCGTTCAGCTGGATGAGC
CGCGCCCGCCACACCGGCAAGATCACCTTCACCATTCCCCGGCGACTCGACCCCGACGGT
ACGGTCCTGATCGCCGACGGAGCAGGCGCCCTGACGGGAACCGTCGCCCGGCATCTGGTG
GCCGAACAGGGCGTGCGTCATCTGCTGCTGCTGTCCCGCAGCACCCCGGACGAAGCACTG
ATCAACGAGCTGATCGAGTCGGGCGCCCGGGTCGACACGGCGGTCTGTGACGTGTCGGAT
CGTGCCGGCCTGGTGCGGACACTGGCCGGGATAGCACCGGAACGCCCTCTCACCGCAGTG
ATCCACACCGGCGGTCCCGCCGTTGCCCACGAGAGCCACCAGCTGCACCGCCTCACGAAA
GGCCTCGACCTCGCCGCCTTCGTCGTCTTCAGCCAAGACGCGCCCGCCTCCGTGGACGCC
CTCGCCCGGAGCCGCCGCGCCGAAGGCCTGCCGATCACGGCGATCGCCTGGGGCATACCC
GAAGCCGAAGCGGTCGTGGTCAGGGGACCCCTGCTGGGCCGCGCGATGGCTTCCGCCGAC
TCGGCGCACATCGTCACCCGTCTGAACACCGTCGGTCTGCGAGCACTGGCCGCGGCCGAC
ACGCTTCCCCCGCTCCTCCAGAACTTGGTCGGTGCGCACACCGACACCACCGAACAGCAG
GCATGGTCGCGGCAGTTCCTAGCCGCGGAGGCTGCCAGAGAACAGGCGTTGCGCGATCTC
GTCCGCAGCAGCGTCACGGACATCCTGGGCCTCTCCGCGGCCGATCGGTACGCCCCTGAC
AAGACGTCCCGCGAGATGGGCATCGACTCGCTGACCTCGGTGGAACTGCGCAACAGCCTG
GCCAAGGCAACGGGTCTGCGGCTGCCAGCCACGTTGGTGTTCGACTATCCGACCCCGGCC
GTGCTCGTCGTCCGGTTGGGGGAGTTGTTCACGGGCGAGAGCCCCGCCCCGGAGCGCGCG
GTGTCGGCGGTGGGGCAAGGCGAGCCGTTGGCGATCGTGGGTATGGCGTGCCGTCTGCCG
GGCGGTGTGTCGTCGCCGGAGGATCTGTGGCGCTTGGTCGAGTCGGGTACGGACGCGATT
TCCGGTTTTCCCACCGACCGTGGCTGGGACGTCGACGGCCTGTTCGATCCGGACCCGGAC
GCGTCCGGGAAGTCGTACTGCGTGCAGGGTGGCTTCCTGGACACCGCGGCCGGCTTCGAT
GCCTCGTTCTTCGGGATCAGCCCGCGTGAGGCGTTGGCGATGGATCCGCAGCAGCGGCTG
GTGCTGGAGGTGTCCTGGGAGGCGTTCGAGCGGGCCGGTATCGAGCCCGGCTCCGTGCGA
GGCAGCGACACCGGTGTCTTCATGGGCGGTTTCCCCGGCGGCTACGGCGCCGGCGCCGAC
CTTGAGGGTTTCGGCGCGACCGCTGGTGCGGCGAGTGTCTTGTCCGGCCGGGTGTCGTAT
TTCTTCGGCCTCGAAGGCCCCGCCATCACGGTGGACACGGCCTGCTCGTCATCGCTGGTG
GCGTTGCACCAGGCGGGGTATGCCCTGCGGCAGGGTGAGTGCTCGCTGGCCCTGGTCGGC
GGTGTCACGGTGATGCCTACGCCGCAAAGTTTCGTGGAGTTCTCCCGCCAGCGCGGCCTG
TCAGCCGATGGCCGGTGTAAAGCCTACGCCGACGCCGCGGATGGCACGGAGTGGGCCGAG
GGCGTCGGCGTGCTTCTGGTGGAGCGCTTGTCGGATGCTCAGGCCAAGGGCCACCAGGTG
TTGGCGGTGGTGCGGGGCTCGGCTGTGAACCAGGACGGTGCGTCGAACGGTCTGTCCGCG
CCGAACGGTCCTTCGCAGCAGCGGGTGATCCGGGCCGCTCTCAGCAACGCCGGTCTGGCG
CCGCACGAGGTGGATGTGGTCGAGGCGCACGGCACGGGTACGACGCTGGGTGACCCGATC
GAGGCCCAGGCGGTGATCGCCACTTACGGCCAGGACCGTGAGCAGCCTGTGTTGCTGGGG
TCGTTGAAGTCGAACATTGGTCATGCGCAGGCCGCGGCGGGTGTGTCGGGTGTCATCAAG
ATGGTGATGGCGCTGCGGCACGGTTTCGTGCCGCGCACACTGCATGTGGATGAGCCGTCG
CGGCATGTGGACTGGTCGGCGGGCGCGGTTGAGCTGGTGGCGGAGAACCGGTCCTGGCCC
GCCACCGGTCGGCCGCGCCGGGCGGGTGTGTCGGCCTTCGGGGTCAGCGGTACGAACGCC
CACGTCATCCTGGAGGGTGCACCGGCACAGTCCGTGGACGACGCGGCCGGCTCAACACCC
GTAGTGGATTCGGAGCTGGTGCCGTTGGTGGTGTCGGCGAAGTCGTTGCCTGCTCTGGCC
GAGGTCGAGGGCCGGTTGCGTGCGTATCTGGCGGCGTCGCCCGGGGCGGATGTGCGGGCT
GTGGGGTCGACGCTGGCGGTGACGCGGTCGCTGTTCGAGCACCGTGCCGTGCTGCTGGGG
GATGACAGCGTCACCGGCACCGGCACCGCTGTGTCTGATCCTCGGGTGGTGTTTGTTTTC
CCGGGTCAGGGGTGGCAGTGGCTGGGGATGGGCAGTGCGCTGCGCACTTCGTCGATGGTG
TTCGCCGAGCGGATGGCCGAGTGTGCGGCGGCGTTGAGTGAGTTCGTGGACTGGGATCTG
TTCGCCGTGCTGGATGATCCGGCGGTGGTGGCCCGGGTTGATGTGGTTCAGCCTGCTTCG
TGGGCGGTGATGGTTTCGCTGGCCGCGGTGTGGCAGGCGGCCGGTGTGCGGCCGGATGCG
GTGGTCGGTCATTCGCAGGGTGAGATCGCCGCGGCGTGTGTGGCGGGTGCGGTGTCGTTG
CGGGATGCGGCGCGGGTTGTGACGTTGCGCAGTCAGGTGATCGCGCGGGGGCTGGCGGGC
CGGGGTGCGATGGCATCGGTTGCGTTGCCCGCGCAGGATGTCGAGCTGGTCGACGGGGCG
TGGGTCGCGGCTCGTAATGGTCCCGCGTCTACGGTGGTTGCGGGTGCGCCGGAGGCGGTG
GACCGTGTGCTGGCGGTTCATGAGGCGCGGGGGGTGCGGGTGCGGCGGATCGCCGTTGAC
TACGCCTCGCACACCCCGCACGTCGAGCTGATCCGTGACGAGCTGCTGGGTGTCATCGCC
GGTGTTGATTCGCGGGCTCCGGTGGTGCCGTGGCTGTCGACGGTGGATGGGACGTGGGTC
GAAGGCCCCTTGGACGCGGAGTACTGGTACCGGAACTTGCGTGAGCCGGTGGGTTTCGAG
CCCGCCGCCGGCCAGTTGCAGGCCCAGGGTGACACCGTGTTCGTGGAGGTCAGCGCCAGC
CCGGTGTTGTTGCAGGCGATGGACGACGATGTCGTCACGGTTGCCACGCTGCGTCGTGAC
GACGGGGACGCCACCCGGATGCTCACCGCCCTGGCGCAGGCATATGTCGAGGGCGTGACT
GTCGACTGGCCTGCGGTGCTGGGTACCACCGCAGCCCGGGTGCTGGACCTTCCGACGTAC
GCGTTCCAGCACCAGCGGTACTGGCTCAAGGGCGTGGACCGGGCGGCTGCCGATGGTCAT
CCACTGCTGGGCACGGTAGTGGCGCTGCCCGGCTCCGATGGTGTGGTGCTGACCGGGCGG
GTGTCGCTGGCCACGCATGCGTGGCTGGCCGATCACGCGGTGCGGGGCAGTGTGCTGCTG
CCCGGGACCGCATTTGTTGAGCTGGTCGTCCGCGCCGCCGGCGAGGTGGGGTGTGACGTT
GTCGATGAGCTGGTGATCGAAACCCCGCTCCTGCTGCCGCAGACTGGCGGTGTGCAAATG
TCCGTATCGGTCGCCGAGGCCGACGAGTCCGGGCACCGCGCGGTGATGGTCTTCTCCCAG
GCGGACAACACCGATACGTGGACCCGGCACGTCACGGCGACAGTCAGCACCTCTGACTCG
ACGGTCTCGCAGCCGGAGTTCGCTGCTTGGCCCCCACCGGCAGGGGCAGAGCCGCTTGAC
CTTAGTGATTTCTACGACCAGCTGACTGGGGCCGGTTACGAGTACGGTCCCGCGTTCCAG
GGGCTGCGGACTGCGTGGCGCGACGGCAACACCGTCTTCGCCGAGGTTGCTCTGGCTGAG
GAGCAGGCGCAGGAGGCGGCACGGTTCGCGGTGCATCCGGCGCTGTTGGACGCCGCCCTC
CACGCCAGCAATTTGAGCACACTCGACACCGCCGAGCAGGGTGTGCGGCTGCCGTTCTCC
TGGAACCAGGTTTGGGTCCACGCCACAGGGCCGGTGATGCTGCGTGTCGCGATAACACGA
ACAGCGGACGGCTGGAGTGTGCTGGTCGCTGACGACAGTGGCCGGCCAGTGGCTAGCGTC
GGTTCGCTCGTGACACGGGTGGTGACGGCCGACGCGCTTGGTTCCGCTGCCGATGAGCTG
CTCGCCCTGACGTGGATGGAGATCCCGGCTCCTCAGGGGACCGGTCTGACGGTCGGCCGG
TTCGAGGATCTGGTGTCGGGTGGTGATGTGCCGGTGCCCGAGGTGGTGGTGTTCACCGCA
CTTCCCGGCAGCAGCGAGACTCCGCTGGACCCGCTGGACCCGCTGGCACAGACTCGCACG
TTGACCGCCCAGGTTCTCCAGGCAGTTCAGGCATGGCTGGCCGGGGAAGGCTTCACGAAC
AGCACGCTGGTCGTGCGGACCGGTACCGGTTTGGCCGCCGCCGGGGTGTCGGGGTTGATG
CGTTCGGTCCAGTCGGAGCATCCGGGCCGGTTCGTTCTGGTGGAATGCGACGACGACACC
CTCACCCCGGACCAGTTGGCGGCGACTGTCGGATTGGACGAGCCGCGGCTGCGGGTCTGC
GACGGCCGGTTCGAGGTACCGCGGCTGGCGCGGGCGAATACGCCGGAAAGCAGCCCGCTG
ACGATCCCCGACAGTCGTGCCTGGCTGTTGGAACAACCCCGCAGCGGAACCTTGCGGGAC
CTCGCTCTGGTACCCACCGACACCGCCGAACGGCCCCTGCAATCCGGTGAAGTACGAGTA
GACGTACGCGCCGCAGGACTCAACTTCCGCGACGTCGTCGTGGCCCTCGGCATGGTTGAC
GACAAACGCCTGGCAGGCGGTGAGGCTGCGGGCGTGGTGCTCGAGGTCGGTCCGGAGGTC
CAGGATCTGGCCCCGGGAGACCGAGTGTTCGGTCTTGTGGGCGGTGGGTTCGGGCGGTCC
GCGATCGCTGATCGCCGAATGCTGGGTGTGATTCCTGACGGGTGGTCGTTCACTACGGCG
GCGTCCGTCCCGGTTGTGTTCGCCACCGCGTACTACGGGCTGGTGGATCTGGCCGGGCTG
AGTGCGGGTGAGTCCGTGCTGATCCACGCCGCCGCGGGTGGTGTCGGCATGGCAGCCACC
CAGATCGCCCGCCACCTCGGCGCGCGGATCTACGCGACCGCCAGCACCGGGAAACAACAC
ATCCTGCGCGAAGCCGGTCTCGAAGACACCCACATCGCCGACTCCCGCACACTGAGTTTC
CAGGAAACCTTCCTCAACAACACACACGGCCAGGGCGTCGATGTCGTCCTGAACTCCCTC
AGCGGTGACTTCGTCGACGCCTCCCTCGACCTGCTGCCCCGCGGCGGCCGGTTCATCGAG
ATGGGCAAGACCGACATCCGTGACCCGCACCAGGTCACCGCCGACCGGCCGGGCACCACC
TACCAGGCCTTCGACCTGATGGACGCCGGCCCGGACCGGCTACGGGAAATCATCACCGAA
CTCCTCACCCTGTTCACGCAAGGCGTCCTACTGCCCCTGCCGGTGCAGGCCTGGGACATC
CGCCAGGCCCGCGATGCGTTCAGCTGGATGAGCCGCGCCCGCCACATCGGCAAGATCGTC
CTCACCATCCCCCGCCGGCCGGACCCCGACGGCACCATCCTGATCACCGGCGGCTCCGGC
GTCCTGGCAGGCATCCTCGCCCGCCACCTGGCAGCCGAACACGGTGCACGTCACCTCCTG
CTGCTGTCCCGCACCACCCCCGACCAAGCACTGATCAAGGAGCTTGCCGAGCTGGGCGCC
CACGTCGACACAGCCACCTGCGACGTGTCGGACCGTGCCGGGCTGGCGCGCGTACTGGCG
GGCGTATCACCCGAACACCCCCTGACCGCCGTGATCCACACCGCCGGCGCACTCGACGAC
GGCGTCGTGGAATCCCTCACCACACAACAGCTCGACACGGTGCTACGGCCCAAGGCCGAC
GGCGCCTGGCACCTACACGAACTCACCCAGAACACCGACCTGGCGGCGTTCGTCATGTAT
TCCTCGGCTGCTGGTGTGCTCGGTAGTGCGGGGCAGGGTAATTATGCGGCGGCCAATGCG
TTCGTGGATGCGCTGGCTGAGCAGCGTCGTGGTGAGGGGCTGCCCGCGCTGGCGGTGGCG
TGGGGTCTGTGGGAGGACACCAGTGGTCTGACCGCGAAGATGACCGATACGGACCGTGAC
CGGATCCGGCGTGGTGGCCTGCGGGCGATCTCCGCGGGCCGGGGGATGGGCTTGCTCGAT
GCCGCGTCACGTCATGGTGAGCCGGTGCTGCTCGCTGCGTCGATGGAGCCTGTGCGTGAT
GTCGAGGTTCCGGCGCTGCTGCGTTTGTTGCATCGTCCGGTTGCCCGGCGGGCTGCTTCT
ACCGGTGATTCGTCGGTGCAGTGGCTGGCCCGGTTGGCGCCGGTGGAGCGGGAGAAGGCG
CTGCTGAAGCTGGTGTGTGATGGCGCCGCGACGGTTCTGGGACATGCCGACGCCAGCACG
ATTCCGGCGACTGGTGCGTTCAGGGATCTGGGCGTGGATTCGCTGACGGCGGTGGAGCTG
CGGAACGGTCTGGCGAAGGCGACAGGGTTGCGGTTGCCCGCCACGTTGGTGTTCGACTAC
CCGACCCCGGCCGCTTTGGCTGCGCGGTTGGAGGAGCTGTTCACCGGCGAGAACCCTGCA
CCGGTACGTACGTCGGTGTCGGTGGTGGCGCAGGACGAGCCGTTGGCGATTGTGGGTATG
GCGTGCCGTTTGCCGGGTGGGGTGTCGTCGCCTGAGGATCTGTGGCGTCTTCTGGAGTCG
GGTACGGACGCGGTCTCCGGATTCCCCACCGATCGTGGCTGGGATGTGGAGAATCTGTTC
GGCCCCGCAGTCGGCAACTCCTATCGCTTGCAGGGTGGCTTCCTGGATGCCGCGGCTGGT
TTCGATGCCTCGTTCTTCGGGATCAGTCCGCGTGAGGCGTTGGCGATGGATCCGCAGCAG
CGGTTGGTGCTGGAGGTGTCCTGGGAGGCGTTTGAGCGGGCCGGGATCAAGCCCGGTTCC
GTACGCGGAACTGATACCGGTGTTTTCATGGGTGCGTACCCCGGTGGCTACGGCATCGGT
GCCGACCTCGGCGGCTTCGGGACAACTGCCGGTGCGGTGAGTGTCCTGTCGGGTCGGGTG
TCGTATTTCTTCGGATTTGAGGGCCCGGCGTTCACGGTCGACACGGCGTGTTCGTCGTCG
TTGGTGGCGTTGCATCAGGCGGGGTATGCCCTGCGGCAGGGTGAGTGTTCGCTGGCCCTG
GTCGGTGGTGTCACTGTGATGGCCACGCCGCAGACTTTCGTGGAGTTCGCTCGTCAGGGT
GGCCTGGCCGGTGACGGTCGCAGTAAGGCGTTCGCGGACAGTGCGGACGGCGCCGGCTTC
TCCGAGGGCGTCGGTGTGCTGTTGGTGGAGCGGCTTTCCGATGCCCGTCGTAACGGTCAC
CAGGTGCTTGCGGTGGTGCGGGGATCGGCGGTCAATCAGGACGGTGCGTCGAACGGTCTG
ACCGCGCCGAATGGTCCTTCGCAGCAGCGGGTGATCCGGGCCGCTCTCAGCAACGCGGGT
CTGAGTACGGCTGAGGTGGATGTGGTCGAGGCGCACGGCACGGGTACGACGCTGGGTGAC
CCGATCGAGGCCCAGGCGTTGATGGCGACCTATGGCCAGGATCGTGAGCAGCCGTTGCTG
CTGGGTTCGGTGAAGTCGAATCTGGGTCATACGCAGGCTGCTGCGGGTGTGTCGGGTGTC
ATCAAGATGGTGATGGCGCTGCAGCGCGGTTTCGTGCCGCGTACGTTGCATGTGGATGAG
CCGTCACGGCATGTGGACTGGTCGGCGGGCGCGGTGCAGCTCGTGACGGAGAACCAGCCC
TGGCCCGGCACCGACCGGCCTCGCCGGGCAGGTGTGTCGTCCTTCGGGATCAGTGGCACC
AACGCCCACGTCATCCTGGAAAGCGCACTCCCCACACAGCCTGCGGGCAACACAGTGGTC
GAGTCGGCACCGGAGTGGGTGCCGTTGGTGATTTCGGCGAGGACCCAGTCGGCACTGGCT
GAATACGAGGGCCGGTTGCGTGCGTATCTGGCGGCGTCGCCCGGGGCGGATACGCGGGCT
GTGGCATCGACGCTGGCGATGACACGGTCGGTGTTCGAGTACCGGGCCGTACTCATTGGA
GATGACACCGTCACCGGTACCGCGGCGACCGATCCGCGGGTGGTGTTCGTCTTCCCGGGT
CAGGGGTCGCAGCGTGCTGGTATGGGTGAGGAACTGGCCGCCGCGTTCCCCGTCTTCGCG
CGGATCCATCAGCAGGTGTGGGATCTGCTGGATGTGCCCGATCTCGATGTGAATGAGACC
GGGTATGCCCAGCCGGCCCTGTTCGCTTTGCAGGTGGCTCTGTTCGGGTTGCTGGAATCG
TGGGGTGTACGGCCGGATGCGGTGGTCGGTCACTCTGTCGGTGAGCTCGCCGCCGGATAC
GTCTCCGGGTTGTGGTCGTTGGAGGATGCCTGCACTTTGGTGTCGGCGCGGGCTCGTCTG
ATGCAGGCTCTGCCTGCGGGTGGGGTGATGGCCGCTGTCCCGGTCTCGGAGGATGAGGCT
CGGGCCGTGCTGGGTGAGGGTGTTGAGATCGCCGCGGTCAACGGGCCGTCGTCGGTGGTT
CTCTCCGGTGATGAGGCCGCCGTGCTGCAGGCCGCGGAGGGGCTGGGGAAGTGGACGCGG
CTGCCGACCAGTCACGCGTTCCATTCCGCCCGTATGGAACCGATGCTGGAGGAGTTCCGG
GCGGTCGCTGAAGGCCTGACCTACCGGACGCCGCAGGTCGCCATGGCCGCTGGTGATCAG
GTGATGACCGCTGAGTACTGGGTGCGGCAGGTCCGGGACACGGTCCGGTTCGGCGAGCAG
GTGGCCTCGTTCGAGGATGCGGTGTTCGTCGAGCTGGGTGCCGACCGGTCACTGGCCCGC
CTGGTCGATGGCATCGCGATGCTGCACGGTGACCATGAGGCGCAGGCCGCTGTCGGTGCC
CTGGCTCACCTGTACGTGAACGGCGTGAGTGTCGAGTGGTCCGCGGTGCTGGGTGATGTC
CCGGTAACCCGGGTGCTGGATCTTCCGACGTACGCCTTCCAGCACCAGCGGTACTGGCTT
GAGGGCACGGACCGGGCGACTGCGGGTGGTCATCCGTTGCTGGGTTCGGTGGTGCGGCTG
GCCGAGGCCAGTGGGGTGTTGTTCACTGCCCGGGTTTCCCGGAGCGGTGATCTGTGGCTG
CGGGACCAGACGGTTCTGCCCGCGACGGTGTTCGTGGAGATGGCGCTGGCAGCGGCGGAC
GAGGTCGGCTGCGGTCTGGTTGAGGATCTGAGTGTGGAAGCGTTGCTGCTGCTTCCCGAT
GATGGCGCCGTCGAGGTACAGACCTGGGTGGGCGAACCGGATGAGGGCGGTCGGCGCCGG
CTCAGTGTCCACGCCCGTTACGGTGACGGCGAGCCCTGGACCTGCTTGGCCACCGCAACC
CTGGCCACCACTACGGGTGTGGCCGCTGCCGCGGTCGGCTGGCAGGCCGGTGGGGTGTGG
CCGCCGGCCGGTGCGGTCCCGGTCGGGACATCGGCACCCTCACTGCGGGCGGTGTGGCGC
CTGGGCAGCGACATCTTCGCCGAGGTGGCCCTGGACGATGCCCATGATGCCACCAGGTTT
GTGCTTCATCCCGCCCTGATGGCCGCCGCGCTCACCACCGTAGGCGAGGAGACTCCCGCC
GTGTGGCAGGGCCTGACCCTGCACGCCGGCAATCCCGGCGAGCTGCGCGTCCGCCTCACC
TCACACGATGACGGCACCCTGTCGGCAGAGGCCACCGACAGCACAGGCCTCCCCGTCCTG
ACCGCCCGCTCGCTCACCCTGCGCACCGTCCCCGTATACGAACCGGCCACCAGCACCGAC
GACCTGCTCACCCTGACCTGGGCAGGAATCCCCACCCCCCAGCAGACCGGCCTGACGGTG
GGTGCGTTTGAAGACCTGGCGGCGGACGGCGATGTGCCGGTACCCGAGGTGGCGGTCTTC
ACCGCACTCCCCGACAGCGACGATCCGCTGGAGCAAACACGAAAGCTGACCGCTCAGGTC
CTCCACACACTCCAGGAGTGGCTTGGCGGGGAGCGCTTCAGCGACAGCACGCTGGTGGTG
CGGACCGGCACCGGGTTGGCCGCTGCTGGGGTGTCGGGGCTGATGCGCTCGGCCCAGTCC
GAACACCCCGGCCGGTTCGTCCTGGTCGAAAGCGACGACGCCCTCACCCAGGATCAGCTG
GCGGCGGCGGTCGGACTGGATGAGCCGCGGCTGCGGGTCAGCGACGGCCGGTACGAAGTA
CCACGGCTGACCCGCACACATGCCGAAGAGCCTGAGCCTGAAAGGACGTGGGATCCGGAT
GGCACGGTCCTGATCACGGGCGGTTCAGGTGTGCTGGCGGGGATCGCCGCCCGGCACCTG
GTGACCGAACGCGGCGTGCGTCATCTCCTGCTGCTGTCCCGCAGCGCCCCGGATGAGGCG
CTGATCGGCGAGCTTGGTGAACTGGGGGCCCGGGTCGAGACAGCGGCCTGTGACGTGTCC
GATCCTGCCGCGCTGACGCAGGTGCTGGCGGGTGTCTCGCCGGAGCATCCCCTGACGGCC
GTGATTCACACCGCGGGCGTGGTGGATGACGGTGTTGTGGAGTCTTTGACCGTGCAGCGG
CTGGAGACGGTACTGCGGCCCAAGGCCGACGGTGCGTGGAACCTGCACGAGCTCACCCGG
GATGCCGACCTGGCCGCGTTCGTCATGTATTCCTCCGCCGCCGGTGTGCTCGGTAGTGCG
GGGCAGGCCAACTACGCGGCGGCCAATGCGTTCCTGGACGCGCTGGCTGAGCAGCGTCAC
GCTGAGGGTCTGCCCGCACTCGCGGTGGCCTGGGGTCTGTGGGAGGACGCCAGTGGCCTG
ACCGCGCAACTGACCGACACGGACCGTGACCGGATCCGGCGCGGTGGCCTGCGGGCCATC
TCCGCCGAGCACGGGATGGGGCTGTTCGACAGCGCGTCACGCCACAGTGAACCGGTTCTG
GTGGCCGCGCCGATGGAGCCGGTACGGGACGCGGAAGTCCCGGCATTGCTGCGGTCGTTG
CACCGCCCGATTGCTCGGCGGGCCGCTGCCGCCGGTGGAGCGCGGTGGCTGGCCGCCCTG
GCACCGGCCGAGCGGGAGAAGGCACTGCTGAAGCTGGTGTGTGACAGTGCCGCGACGGTT
CTGGGACACGCCGACACCAGCACCGTCTCCGTAGCCGCCGTGTTCAGGGATCTGGGTGTG
GATTCGCTGACTGCGGTGGAACTACGGAACAGTCTGGCGAAGGCGACGGGGTTGCGGCTG
CCCGCCACGTTGGTGTTCGACTATCCGACTCCGACGGCTTTGGCTGTTCGGCTGGGGGAG
TTGTTCACCGGCGAGAACCCCGTACCGGTACGCGGGCCGGTGTCGGCGGTGGCGCAGGAC
GAGCCGCTGGCGATCGTGGGAATGGCCTGCCGCCTACCTGGTGGAGTCTCGTCGCCTGAG
GATCTGTGGCGTCTCCTGGAGTCGGGTACAGATGCGGTCTCCGGTTTCCCCACCGACCGT
GGCTGGGACGTCGAGAACCTGTACGACATGGCTGGAAAATCGCACCGTGCTGAGGGTGGC
TTCCTGGATGCCGCGGCTGGCTTTGATGCCGGATTCTTCGGCATCAGTCCGCGTGAGGCG
TTGGCGATGGATCCGCAGCAGCGGCTGGTGCTGGAGGTGTCCTGGGAGGCGTTCGAGCGG
GCCGGGATCGAGCCCGGTTCCGTGCGCGGCAGCGACACCGGCGTCTTCATGGGCGCGTAC
CCCGGTGGTTACGGTGCCGGTGCTGACCTCGGCGGCTTCGCGGCCACCGCCAGCGCGACC
AGTGTCCTGTCCGGCCGGGTGTCGTACTTCTTCGGCCTCGAAGGCCCCGCGTTCACAGTC
GACACAGCGTGTTCGTCGTCGCTGGTCGCCCTGCACCAGGCGGGGTATGCCCTCCGGCAG
GGAGAGTGCTCGCTGGCCCTGGTCGGCGGTGTCACCGTGATGGCCACGCCGGAGCTCTTC
ACCGAGTTCTCGCGGCAGCGTGGTCTGGCCTCCGATGGCCGGTGCAAGGCGTTCGCAGAC
AGCGCGGATGGCACGGGATGGGCTGAAGGCGTTGGTGTGCTGCTGGTAGAGCGACTTTCC
GACGCCCAGGCCAAGGGCCATCAGGTGTTGGCGGTGGTCCGTAGCTCGGCGGTCAACCAG
GACGGCGCGTCCAACGGTCTGACCGCGCCGAACGGCCCCTCCCAGCAGCGGGTGATCCAA
GCCGCTCTCAGTAACGCCGGCCTCGCCGCGCACGAGGTGGATGTGGTCGAGGCCCACGGC
ACGGGTACGACGCTGGGCGACCCGATCGAGGCCCAGGCGGTGATCGCCACTTACGGTCAG
GACCGGGAACGGCCCCTGCTGCTGGGCTCGCTGAAGTCGAACATCGGTCATGCTCAGGCC
GCCTCGGGCGTGTCGGTTGTCATCAAGATGGTCATGGCCCTGCAGCACAACACGGTTCCC
CGCACCCTGCACGTGGATGAGCCGTCGCGGCACGTGGACTGGGCGGCGGGTGCGGTTGAG
CTGGTGAGGGAGAACCAGCCCTGGCCCGGCACCGACCGGCCCCGTCGGGCGGGCGTGTCG
TCCTTCGGAGTCAGCGGCACCAACGCCCACGTCATCCTGGAGAGCGCACCCCCCGCTCAG
CCCGCGGAGGAGGCGCAGCCTGTTGAGACGCCGGTGGTGGCCTCGGATGTGCTGCCGCTG
GTGATATCGGCCAAGACCCAGCCCGCCCTGACCGAACACGAAGACCGGCTGCGCGCCTAC
CTGGCGGCGTCGCCCGGGGCGGATACGCGGGCTGTGGCATCGACGCTGGCGGTGACGCGG
TCGGTGTTCGAGCACCGCGCCGTACTCCTTGGAGACGACACCGTCACCGGCACCGCTGTG
TCCGATCCCCGGGTGGTGTTTGTTTTCCCGGGGCAGGGGTGGCAGTGGCTGGGGATGGGC
AGTGCCCTGCGGGATTCGTCGGTGGTGTTCGCCGAGCGGATGGCCGAGTGTGCGGCGGCG
TTGAGTGAGTTTGTGGACTGGGACCTTACGGTTCTGGATGATCCGGCGGTGGTGGACCGG
GTTGATGTGGTCCAGCCCGCTTCGTGGGCGGTGATGGTTTCCCTGGCCGCGGTGTGGCAG
GCGGCCGGTGTGCGGCCGGATGCGGTGATCGGGCATTCGCAGGGTGAGATCGCCGCGGCG
TGTGTGGCGGGTGCGGTGTCGTTGCGGGATGCCGCCCGGATCGTGACCTTGCGCAGCCAG
GCGATCGCCCGGGGCCTGGCGGGCCGGGGCGCGATGGCATCCGTCGCCCTGCCCGCGCAG
GATGTGGAGCTGGTCGACGGGGCCTGGATCGCCGCCCACAACGGTCCCGCCTCCACCGTG
ATCGCGGGCACCCCGGAAGCGGTCGACCATGTCCTCACCGCTCATGAAGCGCGAGGGGTG
CGGGTGCGGCGGATCACCGTCGACTATGCCTCGCACACCCCTCATGTCGAGCTGATCCGC
GACGAACTGCTCGACATCACTAGCGACAGCAGCTCGCAGGCCCCGCTCGTGCCGTGGCTG
TCGACCGTGGACGGCTCCTGGGTCGACAGCCCGCTGGACGGGGAGTACTGGTACCGGAAC
CTCCGTGAGCCGGTCGGTTTCCACCCCGCCGTCGGCCAGTTGCAGGCCCAGGGCGACACC
GTGTTCGTCGAGGTCAGCGCCAGCCCGGTGCTGTTGCAGGCGATGGACGACGATGTCGTC
ACGGTTGCCACGCTGCGTCGTGACGACGGCGACGCCACCCGGATGCTCACCGCCCTGGCA
CAGGCCTATGTCCACGGCGTCACCGTCGACTGGCCCGCCATCCTCGGCACCACCACAACC
CGGGTACTGGACCTTCCGACCTACGCCTTCCAACACCAGCGGTACTGGGTCGAGGGTGTG
GATCGCTCGGCTGCGGGTGGTCATCCGTTGCTGGGTGTGGCCGTGGAGTTGCCGGACTCC
AATGGTGTGGTGCTGACCGGGCGGGTGTCGCTGGCCACCCATACATGGCTGGCCGATCAC
GCGGTCCGGGGCAGTGTCCTGCTCCCCGGGACCGCATTTGTGGAACTGGTCGTCCGAGCC
GCCGACGAGGTCGAGTGCGACGTTATCGATGAGCTGGTGATCGAAACCCCGCTCCTGCTG
CCGCAGACCGGAGGCGTCCAACTGTCCGTGTCCGTCGCGGAGGCCGATGAGTCCGGACAC
CGCGCGGTGACGGTCTTCTCCCGGGCGGACAACGCGGACACATGGACCCGGCACGTTTCC
GCCACGATCAGCGCCTCTGATGCACCCCTCTCGCTGCCGGAGTTTGCCTCGTGGCCGCCA
GCCCAGGCCCAGCCGACGAACGTGGGCGACCTCTACGACCGGCTGGCTGCCGCAGGTACC
GAGTACGGTCCCGCGTTCCAGGGGCTGCAGGCCGCGTGGCGTGACGGGGACACCGCCTAC
GCCGAGGTCGCTCTGGCCGAGGAGCAGGCGCAGGAGGCGGCACGGTTCGCGGTGCATCCG
GCGCTGTTGGACGCCGCCCTGCACGCCAGCGTCTTGCACACACCCGACGCTGAGCAGCAG
AGCCTGCGGATGCCGTTCTCCTGGAGCCACGTCCAAGTCCATGCCACTGGCTCGGCCACG
CTGCGCGTCGCGATGACACCGACAACAGACGGCTGGAGTGTGCACGTCGCCGATGACGAC
GGTCGGCCGGTGGCCACCATCGGCTCATTCGTGACGCGCCCGGTGACAGCCGACGCGCTC
GGCTCCGCAGCCGATGACCTGCTCAGGGTGGTCTGGACGGAGATCCCCATTCCCCAGCAG
ACCGGTCTGACCACTGGCCGGTTCGAGGATCTCGTGGACGCCGATGTGCCGGTGCCCGAG
GTGGTGGTCTACACCGCGCGTCCCGACACCGACGGCAGCCCTGATCCGCTGGCACAGACT
CGCACGTTGACCGCCCAGGTTCTCCAGGCAGTCCAGGCATGGCTGGCCGGGGAACGTTTC
ACCGACAGCACGCTGGTCGTGCGGACCGGCACCGGGTTGGCCGCCGCCGCGGTGTCAGGG
CTGATGCGTTCGGTCCAGTCGGAGCACCCGGGCCGGTTCGTTCTGGTGGAAGGCGACGAC
GACACCCTCACCCCGGACCAGCTGGCGGCGACCGCCGGGCTGGACGAGCCGCGGCTGCGG
GTCTGCGACGGCCGGTTCGAGGTACCGCGGCTGGCGCGGGCGAATACGCCGGAGAGCAGC
CCGCTGACGATCCCCGACGATCGTGCCTGGCTGCTGGAACAACCCCGCAGCGGAACCCTG
CAAGACCTCGCTCTGGTACCCACCGACACCGCCGAACGGCCCCTGCGACCCGGCGAAGTA
CGCATAGACGTACGCGCCGCAGGCCTGAACTTCCGCGACGTTCTTATCGCGCTCGGCACT
TATCCCGGTGAGGCTGTGATCGGGGCTGAAGCTGCGGGCGTGGTGCTCGAGGTCGGCCCG
GAGGCCCACGACCTGGCCCCGGGAGACCGAGTGTTCGGTCTTGTGGGCGGCGGATTCGGG
GCGGTCGCGATCGCCGACCGTCGAATGCTCGCCGTGATTCCTGATGGCTGGTCGTTCACT
ACGGCGGCGTCCGTGCCGGTTGTGTTCGCCACCGCGTATTACGGGCTGGTGGATCTGGGC
GGGCTGAGTGCGGGTGAGTCCGTGCTGATCCACGCCGCCGCGGGTGGTGTGGGCATGGCA
GCGACCCAGATCGCTCGCCACCTCGGCGCGCAGATCTACGCGACCGCCAGCGCGGGCAAG
CAGCACATTCTGTACGAGGCGGGTCTGGACGGCACTCGGATCGCGGATTCCCGCACCACG
GGCTTCCGGGAAGCGTTCCTGAACACTACCGACGGCCGGGGTGTCGATGTCGTCCTGAAC
TCCCTCAGCGGTGACTTCGTCGACGCCTCCCTCGACCTGCTGCCCCGCGGCGGCCGGTTC
GTGGAAATCGGCAAGACCGACATCCGCGACCCGCACCGGATCACCGCCGACCGGCCCGGC
ACCACGTACCAGGCGTGCGACCTGATGGACGTCGGCCCGGACCGGCTGCGGGAGATCATT
ACCGAAATCCTCAGCCTGTTCGGACAAGGCGTCCTACAGCCGCTGCCCGTACAAACTTGG
GACATTCGCCAAGCTCGCGATGCGTTCAGCTGGATGAGCCGCGCGCGGCACATCGGCAAG
ATCGTCCTCACCATCCCCCGCCGGCCGGACCCCGACGGCACCATCCTGATCACCGGCGGT
TCCGGCGTTCTGGCAGGCATCCTCGCCCGCCACCTGGCAGCCGAACACGGTGCACGTCAC
CTCCTGCTGCTGTCCCGCACCGCTCCCGACGAAGCACTGATCAAGGAGCTTGCCGAGCTG
GGCGCCCGGGTCGAGACAGCGGCCTGCGACGTGTCGGACCGTGCCGGGCTGGCACGGGTG
CTGGCGGGCGTATCACCGGAACACCCGCTGACGGCGGTGATCCACACCGCCGGCGCACTC
GACGACGGCGTCGTGGAATCCCTCACCACACAACAGCTCGACACGGTGCTACGGCCCAAG
GCCGACGGCGCCTGGCACCTACACGAGCTCACCCGGGATGCCGACCTGGCGGCATTCGTC
GTGTACTCGTCGGCTGCCGCTGTGCTGGGTAATGAGGGGCAAGGCAACTACGCGGCGGCG
AACGCGTTCCTGGACGCCCTGGCCGAACAACGGCGTACCCAGGGCCTGCCCGCACTCGCG
CTGGCGTGGGGTCCGTGGGAGTACACCGGGGACCTGACCGCGCAACTGACCGGCACCGAC
CAGGACCGGATCCGGTGCAGCGGCATGCGAACCATCACCGCTGAGGACGGAATGCGGCTG
TTCGACACCGCGTCGCACCATGGCGAACCGCTCTTGGTGCCCGCGGTGTTGGACCCGACC
CGAGACGGCGAAGTCCCTGCGTTGCTGCGTTCGTTGCGTCGCCCGATTGCCCGGCGGGCC
GCTTCCGCCGACGGTGGGGTGCAGTGGCTGGCCGCCCTGGCACCGGCCGAGCGGGAGAAG
GCGCTGCTGAAGCTGGTGTGTGACAGTGCCGCCATGGTTCTGGGGCACGCCGACGCACGC
AGCATTCCGGCGGCTGGCGCGTTCAAGGATCTGGGTGTGGATTCGCTGATGGCGGTGGAA
CTACGGAACGGTCTGGTGAAGGCGACGGGGTTGCGGTTGCCGGCCACGTTGGTGTTCGAC
TATCCGACCCCGACGGTCTTGGCTGCTCGGTTGGACGAGTTGTTCACCGGCGAGAACCCT
GCACCGGTACGCGGGCCGGTGTCGGTGGTGGGGCAGGACGAGCCGTTGGCGATTGTGGGT
ATGGCGTGCCGTTTGCCGGGTGGGGTGTCGTCGCCGGAGGATCTGTGGCGTTTGGTCGAG
TCGGGTACGGATGCGGTCTCCGGATTTCCCACTGACCGTGGCTGGGACGTGGAGAACCTG
TACGACTCTGATCCGGAGGCGGCGGGGAAGTCGTATTGCGTGCAGGGTGGCTTCCTGGAC
ACGGCGGCTGGCTTCGACGCCGGATTCTTCGGGATCAGTCCGCGTGAGGCGTTGGCGATG
GATCCGCAGCAGCGGCTGCTGTTGGAGGTGTCCTGGGAGGCGTTCGAGCGGGCCGGGATC
GAGCCCGGTTCCGTACGCGGCAGCGACACCGGCGTTTTCATAGGGGCATTCCCCGTTGGC
TACGGCGCCGGGTTCGATCGCGAAGGTTATGGCGCCACGTCCGGCCCCAGCGTGTTGTCC
GGCCGGGTGTCGTACGTCTTCGGCCTTGAGGGCCCGGCGATCACGATGGACACGGCGTGC
TCCTCGTCCCTGGTTGCTTTGCATCTGGCGGCGCAGGCGTTGCGCAATGGTGAGTGTTCG
ATGGCGTTGGCCGGTGGTGTGACGGTGATGGCCACGCCGGAGGTCTTCACCGAGTTCGCC
CGGCAGCGTGGTCTGGCCTCCGATGGCCGGTGCAAGGCGTTCGCGGACAGTGCGGACGGT
GCCGGTTTCTCCGAAGGCGCGGGTCTGCTGCTGGTCGAGCGGCTGTCCGACGCCCGCCGT
AACGGTCACCAGGTGTTGGCGGTGGTGCGTGGATCGGCGGTGAACCAGGACGGTGCGTCG
AACGGTCTGACCGCGCCGAATGGTCCTTCGCAGCAGCGGGTGATTCGGGCCGCTCTCAGC
AATGCGGGTCTGAGTACGGCTGACGTGGATGTGGTCGAGGCGCACGGCACGGGTACGACG
CTGGGTGACCCGATCGAGGCCCAGGCGCTGCTGGCGACCTATGGCCAGGACCGTGAGCAG
CCGTTGCTGCTGGGCTCGTTGAAGTCGAACATCGGTCATACGCAGGCTGCCTCGGGTGTG
TCGGGTGTTATCAAGATGGTGATGGCGCTGCGGCACGGTTTCGTGCCGCGCACGTTGCAT
GTGGATGAGCCGTCGCGGCATGTGGACTGGGCGGCGGGTGCGGTTGAGCTGGTGAGGGAG
AACCAGCCCTGGCCCGGCACCGACCGGCCCCGCCGGGCAGGCGTGTCATCCTTCGGAGTC
AGCGGCACCAACGCCCACGTCGTCCTGGAGAGCGCACCCCCCGCACAGCCCGCGGAAGAG
GAGCAGCCTGTTGAGACGCCGGTGGTGGCCTCGGATGTGCTGCCGCTGGTGATATCGGCC
AAGACCCAGCCCGCCCTGACCGAACACGAAGACCGGCTGCGCGCCTACCTGGCGGCGTCG
CCCGGGGCGGATACGCGGGCTGTGGCATCGACGCTGGCGGTGACGCGGTCGGTGTTCGAG
CACCGCGCCGTACTCCTTGGAGATGACGCCGTCACCGGCACCGCGGTGACCGACCCCCGG
GTGGTGTTTGTTTTCCCGGGGCAGGGGTGGCAGTGGCTGGGGATGGGCAGTGCACTGCGG
GATTCCTCGGTGGTGTTCGCCGAGCGGATGGCCGAGTGTGCGGCGGCGTTGAGTGAGTTT
GTGGACTGGGATCTGTTCGCCGTGCTGGATGATCCGGCGGTGGTGGACCGGGTTGATGTG
GTTCAGCCTGCTTCGTGGGCGGTGATGGTTTCGCTGGCCGCGGTGTGGCAGGCGGCCGGT
GTGCGGCCGGATGCGGTGATCGGTCATTCGCAGGGTGAGATCGCCGCGGCCTGTGTGGCC
GGTGCGGTGTCACTACGCGATGCCGCCCGGATCGTGACCTTGCGCAGCCAGGCGATCGCC
CGGGGCCTGGCGGGCCGGGCCGCGATGGCATCCGTCGCCCTGCCCGCGCACGAGATCGAG
CTGGTCGACGGGGCCTGGATCGCCGCCCACAACGGTCCCGCCTCCACCGTGATCGCGGGC
ACCCCGGAAGCAGTCGACCATGTCCTCACCGCTCATGAAGCACGAGGGGTGCGGGTGCGG
CGGATCACCGTCGACTATGCCTCGCACACCCCCCACGTCGAGCTGATCCGCGACGAACTA
CTCGGCATCACCGCCGGTATCGGTTCGCAGCCTCCGGTGGTGCCGTGGCTGTCGACGGTG
GACGGCTCCTGGGTCGACAGCCCGCTGGACGGGGAGTACTGGTACCGGAACCTGCGTGAG
CCGGTTGGTTTCCACCCCGCCGTCAGTCAGTTGCAGGCTCAGGGCGACGCCGTGTTCGTG
GAGGTCAGCGCGAGTCCGGTGTTGTTGCAGGCGATGGACGACGATGTCGTCACGGTTGCC
ACGCTGCGTCGTGACGACGGGGACGCCACCCGGATGCTCACCGCCCTGGCACAGGCCTAT
GTCCACGGCGTCACCGTCGACTGGCCCGCCATCCTCGGCACCACCACGGCCCGGGTGCTG
GACCTTCCGACCTACGCCTTCCAACACCAGCGGTACTGGGTCAAGAGCGTGGACCGGGCG
GCTGCGGATGGTCATCCGTTGCTGGGTGCGGTGGTGGAGTTGCCTGAATCCGATGGTGTG
CTGTTGACCGGGCGGGTATCGCTGGCCACCCACGCGTGGCTGGCTGATCACGCGGTCTGG
GGCAGAGTCCTGCTGCCCGGTACCGCATTTGTGGAGCTGGTTGTCCACGCCGCTGGCGAG
GTCGGTTGTGACGTTGTCGATGAGCTGGTGATCGAAACCCCGCTCCTGCTGCCGCAGACC
GGCGGTGTGCAATTGTCCGTGTCCGTCGGCGAGGCCGACGAGTCCGGACACCGGGTGGTG
ACGGTCTTCTCCCGGGCGGACAACGCCGATACCTGGACCCGGCACGTTTCCGCCACCGTC
AGGGTTTCCGACACGACTGTCCCACCGTCGGACCTCACCGCGTGGCCACCTGCGCAGGCC
AAGCCGGTGGACGTGGCGGGCTTCTACGACCAGCTGACCGGGATGGGTTACGAGTACGGA
CCTGCCTTCCAGGGTTTGCAGGCCGCGTGGCGTGATGGGGACACTGTCTTCGCCGAGGTG
GCTCTGGCTGAGGAGCAGGTGCGGGAGGCGGCGCGATATGCCGTGCATCCGGCTCTACTG
GATGCGGCTCTGCATGCCTGCACCTTGAATGCGTCCGATGCCGAGGTGGGTGTGGGGCTG
CCGTTCTCCTGGAACGGTGTTCGGGTCCATGCTGGTGGTTCGGCCATGTTGCGTGTCGCG
GTGACGCAGGCGGCGGATGGCTGGAGTGTGCGGGTCGCTGATGACATCGGTCGGCCGGTG
GCTAGCGTGGGTTCGCTCGTGACGCGCCCGGTGACGGCCGACGCGCTCGGTTCCGCTGCC
GATGACCTGCTCGCCTTGACCTGGGCAGGAATCCCCACCCCCCAGCAGACCGGCCTGACG
GTCGGCCGGTTCGAGGAGCTGGTGTCGGACGGTGATGTGCCGGTGCCCGAGGTGGCGGTC
TTCACCGCACTCCCCGACAACGACGACGACCCGCTGGAGCAAACACGAAAGCTGACCGGT
CAGGTCCTCCAGGCAGTTCAGGAGTGGCTTGGCGGGGAGCGCTTCAGCGACAGCACGCTG
GTGGTGCGGACCGGTACTGGTTTGGCCGCTGCTGCGGTGTCGGGTTGGATGCGGTCGGCC
CAGTCCGAACACCCCGGCCGGTTCGTCCTGGTCGAGAGTGATGACGACGCCCTCGCTCCG
GATCAGCTGGCGGCGGCGGTCGGACTGGATGAGCCGCGGCTGCGGATCAGCGACGGCCGC
TTCGAAGCGCCACGACTGACCCGTACGCATGCCGCTGAACCCGAGTCAGAGAAGGTGTGG
GATCCGGATGGCACGGTCCTGATCACCGGTGGTTCGGGTGTGCTGGCGGGGATCGCCGCC
CGGCACCTGGTGGCCGAACGCGGCGTGCGTCATCTCCTTCTGCTGTCCCGCAGCGCCCCG
GACGAGGCACTGATCAACCAACTCGGCGAACTGGGAGCCCGGGTCGAGACAGCGGCCTGT
GACGTGTCCGATCGTGCCGCGCTGGCCCAGGTGCTGGCGGGTGTGTCACCGGAGCACCCC
CTGACGGCCGTGATTCACACCGCGGGCGCACTCGATGACGGTGTGGTCGAATCTTTGACC
GCGCAGCGGCTGGACGCGGTGTTGCGGCCCAAGGCCGATGGCGCGTGGAACCTGCACGAG
CTCACCCGGGATGCCGACCTGGCGGCGTTCGTCATGTATTCCTCCGCCGCCGGTGTGCTC
GGTAGTGCGGGGCAGGCCAACTACGCGGCGGCCAATGCGTTCGTGGACGCGCTGGCTGAG
CAGCGTCGTGCCGAGGGTCTGCCCGCACTCGCGGTGGCCTGGGGTCTGTGGGAGGACGCC
AGTGGCCTGACCGCGGACCTGACCGACACGGACCGTGACCGGATCCGGCGCGGTGGCCTG
CGGGCCATCTCCGCCGAGTACGGGATGGGGCTGTTCGACAGCGCGTCACGCCATAGTGAA
CCGGTTCTGGTGGGCGCGGCGATGGAGCCGGTACGGGACGCGGAAGTCCCGGCGCTGCTC
CGGTCGTTGCACCGGCCGATTGCTCGCAGGGCCGCCTCTACCGGTGACTCGTCAGTGCAG
TGGTTGGCAGCTTTGGCACCGGAGGAACGGGCGAAGGCGTTGTTGAGGGTGGTGTGTGAC
AGCGCCGCGACGGTTCTGGGACACGCCGACATCGACAGCATTCCCGTGACCGCGGCGTTC
AAGGATCTGGGTGTGGATTCGCTGACCGCAGTGGACCTGCGGAACAGTCTGGCGAAGGCG
ACGGGCCTGCGGCTGCCGCCCACGTTGGTGTTCGACTACCCCACCCCGACGGCCCTGGCC
GCCCGGCTGGACGAGTTGTTCGCTCCGGCGGAGCCGGAACCTCGCCTCCACGAGCAGGAG
CTACGCCGAGCGCTCGCGGGGATCTCGATTGACAAGTTCCGGGAGGCCGGTGTGCTGGAC
ACGCTGCTGAGGCTGGCAGCCATGGAGGGCCTGGCCGTTCCAAAGCCCGATTCGGAATCC
GATGACGAGGCCTTCGTCGATGAGATGGACGCTGACGCTCTCATCAAGCACGTGCTGGAG
GAAGAACGATGA
[0] A35..438
[0] ER684..990
[0] kr1000..1143
[0] PCP1217..1287
[1] KS1308..1677
[1] AT1817..2120
[1] methylmalonyl-CoA2001..2005
[1] DH2160..2322
[1] ER2616..2921
[1] KR2931..3107
[1] ACP3197..3271
[2] KS3293..3659
[2] AT3795..4034
[2] malonyl-CoA3965..3969
[2] dh4111..4258
[2] KR4521..4697
[2] ACP4785..4859
[3] KS4881..5246
[3] AT5386..5688
[3] methylmalonyl-CoA5569..5573
[3] dh5728..5889
[3] er6178..6483
[3] kr6493..6668
[3] ACP6758..6832
[4] KS6854..7222
[4] AT7362..7665
[4] methylmalonyl-CoA7546..7550
[4] DH7705..7866
[4] KR8144..8320
[4] ACP8410..8484
[0] A103..1314
[0] ER2050..2970
[0] kr2998..3429
[0] PCP3649..3861
[1] KS3922..5031
[1] AT5449..6360
[1] methylmalonyl-CoA6001..6015
[1] DH6478..6966
[1] ER7846..8763
[1] KR8791..9321
[1] ACP9589..9813
[2] KS9877..10977
[2] AT11383..12102
[2] malonyl-CoA11893..11907
[2] dh12331..12774
[2] KR13561..14091
[2] ACP14353..14577
[3] KS14641..15738
[3] AT16156..17064
[3] methylmalonyl-CoA16705..16719
[3] dh17182..17667
[3] er18532..19449
[3] kr19477..20004
[3] ACP20272..20496
[4] KS20560..21666
[4] AT22084..22995
[4] methylmalonyl-CoA22636..22650
[4] DH23113..23598
[4] KR24430..24960
[4] ACP25228..25452

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [35-438]  1.99999999999999e-103 PF00501
PF00501   AMP-binding
IPR001227 Acyl transferase domain (Domain)
 [1809-1937]  G3DSA:3.40.366.10 [2001-2110]  G3DSA:3.40.366.10 [3785-3904]  G3DSA:3.40.366.10 [3965-4046]  G3DSA:3.40.366.10 [5378-5505]  G3DSA:3.40.366.10 [5569-5678]  G3DSA:3.40.366.10 [7355-7482]  G3DSA:3.40.366.10 [7546-7655]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [1000-1085]  1.1e-14 PF00106
PF00106   adh_short
IPR002364 Quinone oxidoreductase/zeta-crystallin, conserved site (Conserved_site)
 [2743-2764]  PS01162 [6305-6326]  PS01162
PS01162   QOR_ZETA_CRYSTAL
IPR006162 Phosphopantetheine attachment site (PTM)
 [1245-1260]  PS00012 [3229-3244]  PS00012 [4817-4832]  PS00012 [6790-6805]  PS00012 [8442-8457]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1215-1286]  7.79999999999999e-97 G3DSA:1.10.1200.10 [3199-3273]  7.79999999999999e-97 G3DSA:1.10.1200.10 [4787-4858]  7.79999999999999e-97 G3DSA:1.10.1200.10 [6760-6834]  7.79999999999999e-97 G3DSA:1.10.1200.10 [8419-8486]  7.79999999999999e-97 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1217-1287]  PS50075 [3197-3271]  PS50075 [4785-4859]  PS50075 [6758-6832]  PS50075 [8410-8484]  PS50075
PS50075   ACP_DOMAIN
 [1210-1324]  9.70001793430487e-26 SSF47336 [3194-3309]  3.39999972437717e-29 SSF47336 [4782-4897]  2.90000354677981e-27 SSF47336 [6755-6870]  1.39999892049878e-25 SSF47336 [8405-8491]  1.39999892049878e-21 SSF47336
SSF47336   ACP_like
 [1220-1282]  2.6e-08 PF00550 [3205-3270]  3.4e-11 PF00550 [4793-4855]  3.5e-11 PF00550 [6766-6830]  3.3e-08 PF00550 [8417-8483]  7.30000000000002e-13 PF00550
PF00550   PP-binding
IPR011032 GroES-like (Domain)
 [674-829]  1.20000117458134e-29 SSF50129 [2605-2761]  1.50000306971104e-31 SSF50129 [6168-6323]  3.10001307370206e-33 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [2754-2851]  3.60000000000001e-16 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [703-758]  6.80000000000001e-07 PF08240 [2636-2690]  9.20000000000002e-07 PF08240 [6197-6252]  2.2e-07 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [2931-3106]  7.79999999999999e-62 PF08659 [4521-4696]  9.9e-62 PF08659 [6493-6667]  1.80000000000002e-62 PF08659 [8144-8319]  9.9e-62 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [1308-1553]  3.79999999999991e-91 PF00109 [3293-3535]  2.99999999999998e-84 PF00109 [4881-5122]  1.20000000000001e-88 PF00109 [6854-7098]  2.99999999999998e-91 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [1561-1677]  2.8e-47 PF02801 [3543-3659]  1.09999999999999e-46 PF02801 [5130-5246]  2.8e-44 PF02801 [7106-7222]  6.29999999999998e-48 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [1817-2120]  1.10000000000001e-81 PF00698 [3795-4034]  1.99999999999999e-43 PF00698 [5386-5688]  2.50000000000001e-82 PF00698 [7362-7665]  1.10000000000001e-83 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [1815-2109]  1.70000295590053e-56 SSF52151 [3793-4065]  1.90000694315261e-54 SSF52151 [5384-5677]  2.60000517657733e-56 SSF52151 [7360-7654]  1.20000117458134e-57 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [1940-2000]  4.99999811956429e-15 SSF55048 [3906-3964]  2.39999798157265e-12 SSF55048 [5508-5568]  9.89999630839718e-16 SSF55048 [7485-7545]  1.49999977583352e-14 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [1311-1565]  G3DSA:3.40.47.10 [1566-1729]  G3DSA:3.40.47.10 [3296-3547]  G3DSA:3.40.47.10 [3548-3709]  G3DSA:3.40.47.10 [4884-5134]  G3DSA:3.40.47.10 [5136-5299]  G3DSA:3.40.47.10 [6857-7110]  G3DSA:3.40.47.10 [7111-7275]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [1300-1675]  4.50001022902825e-100 SSF53901 [3285-3657]  3.79997359309398e-99 SSF53901 [4873-5244]  9.30000048475962e-97 SSF53901 [6846-7220]  2.39999798157263e-104 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [819-914]  9.09999999999992e-55 G3DSA:3.40.50.720 [999-1091]  2.39999999999997e-113 G3DSA:3.40.50.720 [2751-2846]  9.09999999999992e-55 G3DSA:3.40.50.720 [2931-3114]  G3DSA:3.40.50.720 [4521-4703]  G3DSA:3.40.50.720 [6313-6409]  9.09999999999992e-55 G3DSA:3.40.50.720 [6493-6677]  G3DSA:3.40.50.720 [8144-8326]  G3DSA:3.40.50.720 [8399-8418]  G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [1466-1482]  PS00606 [3448-3464]  PS00606 [5035-5051]  PS00606 [7011-7027]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [1819-2101]  2.19999900980707e-94 SM00827 [3797-4063]  2.99998750445706e-91 SM00827 [5388-5669]  8.70005082121738e-100 SM00827 [7364-7646]  2.50000909916183e-100 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1218-1290]  5.20000089003336e-23 SM00823 [3202-3274]  1e-31 SM00823 [4790-4862]  2.49999811956465e-30 SM00823 [6763-6835]  7.19999557654549e-29 SM00823 [8415-8487]  3.80000697093586e-31 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [2160-2322]  6.69996745106047e-79 SM00826 [4111-4258]  9.49996855930963e-47 SM00826 [5728-5889]  3.39999972437719e-80 SM00826 [7705-7866]  3.49999466863949e-84 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [1310-1729]  SM00825 [3295-3711]  SM00825 [4883-5298]  SM00825 [6856-7274]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1000-1143]  4.89999951782359e-12 SM00822 [2931-3107]  4.79998722798115e-56 SM00822 [4521-4697]  1.99999636034521e-58 SM00822 [6493-6668]  6.10002656149838e-58 SM00822 [8144-8320]  1.60000240695997e-59 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [684-990]  SM00829 [2616-2921]  SM00829 [6178-6483]  SM00829
SM00829   PKS_ER
IPR020845 AMP-binding, conserved site (Conserved_site)
 [167-178]  PS00455
PS00455   AMP_BINDING
IPR025110 Domain of unknown function DUF4009 (Domain)
 [478-505]  3.5e-06 PF13193
PF13193   DUF4009
SignalP
 [1-18]  0.13 Signal
Eukaryota   
TMHMM No significant hit