close all open/close all

CDS information : Rapam_00130


close this sectionLocation

Organism
StrainNRRL 5491
Entry nameRapamycin
Contig
Start / Stop / Direction67,319 / 71,944 / + [in whole cluster]
67,319 / 71,944 / + [in contig]
Location67319..71944 [in whole cluster]
67319..71944 [in contig]
TypeCDS
Length4,626 bp (1,541 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)pipecolate incorporating enzyme
Gene
Gene (GenBank)rapP
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[7644502] The biosynthetic gene cluster for the polyketide immunosuppressant rapamycin. (Proc Natl Acad Sci U S A. , 1995)
[8635730] Organisation of the biosynthetic gene cluster for rapamycin in Streptomyces hygroscopicus: analysis of genes flanking the polyketide synthase. (Gene. , 1996)
[9266694] The pipecolate-incorporating enzyme for the biosynthesis of the immunosuppressant rapamycin--nucleotide sequence analysis, disruption and heterologous expression of rapP from Streptomyces hygroscopicus. (Eur J Biochem. , 1997)
Related Reference
ACC
Q9KID8
NITE
Asco_00160
PmId
[15835888] Elucidating the substrate specificity and condensation domain activity of FkbP, the FK520 pipecolate-incorporating enzyme. (Biochemistry. , 2005)

close this sectionPKS/NRPS Module

15 L-pipecolate
16
C39..332
A521..922
PCP1007..1074
C1092..1389

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [pipecolate incorporating enzyme]
MASDSPRPRPLKPAFAVSRTQRQRRRLDERGISRADRNGPLPASFSQQRLWLMQQVAPDS
NSYNLPLVQRLRGALDTVILRRALGLVASRHEALRTVFDAEDGEPLQRIQPADVVRLREL
DARDEDHARALVRRETAEPFDLHAGPVMRALLVRLADDDHVLALTVHHIAGDGWSLAILR
MELSAQYAPLLRGAEADLPALPSQYADFAQWERKALSGTKLQKRLDYWQENLRDAPMVLG
LPADRPRPPVGSSDAGTVAWCPPTELVTAAKELSRSTGTTLFMSLLAAFQVVLSHYARTD
DVLVGTPIANRNHAEVEGLIGMFVNTVVLRGDLSGDPTFRELLLRTRTNAMGAFANAELP
FDLLVEKVAPQRDLSVNPVVQVLFQLMPLASNTFTLPGIAVEPFDMNQFFTRMDLEFHVY
EDPAGDRLTGEVWYSRALFDGPRIERMLDQFTLVLRSVLDNPDVPISQISLAPEIGTDLP
TVEANETDRDLPFDSLPELLADAAARNPDAIAVVDERVTLTYAELGGRANKMAHLLRHKG
VRPGELVGLCVDRGADMIRGHARILKAGAGYVPIDPEHPIERTRFGLDDSSISTGIAQET
YRTRFPDVRDIILPDDPGLENQPASPPDVTTDRNSLAYAIYTSGSTGRPKAVLMPGICVV
NLLLWQERTMGREPASRTAQFITATFDYSVQEIFSALLGGTLVIPPDDIRLDPARLAQWI
DDSRITRIYAPTTVLRALVEHVDPHGHGLVDIASPLPGGESLVLDGKLRECALHRPHLRV
HNHYGPAESQLVTGYTLPEDVSAWPSTTPIGKPIDNTRIHLLDDALRPYPTAYAAQVCIS
GIGLARGYLARPELTRQRFITEGTGSEPRMYLSGDLARRLPDGNLEFLGRIDDQVKIRGI
RIELGEIETALSEHAAITQAAVTVREDDRGDKRLVAYVVPHSDAGDLAVELRGHVEARLP
SYMVPSAFIVLDKLPLTTSGKTDRRALPAPESWSPGPTSPVSPRNATESTVCGIYADVLE
VQTVGVHDDFFALGGHSLLASRAVSRIRAELGCDLPLRTLFDVRTPALLAQAIGSMSSRD
MPVLAPSPRTTPAPISLAQQQLLGISDSLLDLGAFPVCPYGFRLRGEIDRTVLDTALTRI
VARHEPLRTGFRDDGDGFVQIVREPAPVRAEFIEVTGKDTTDREAAAAEIAKNELERPFD
LVDGILLRAVLLRLEQDDHILILMLHHIAGDGWSFDVLVRELSALYAECRVPVAGLTEVG
TTYSDFARWEHEALSGSIREEHDAYWREHLKGAVALELPTDRPRKLADPIGKSLEWTVSP
DATAAARRLAQAEGVTLYETMLGAFTLAAAGLSGLDDILVATPFANRGRPEIDHLIGFFA
KVAALRVDLSDDPTFREVLRRVQTAVLGAHAHQDLPYAAIQATATATATATATATASELP
PPLVQFQLISSLTSDLVLPGTTIERFGMVEADLGVGNGELAIWLFDDDSALHGTVVFDGS
LFDPARIQSLLSSVESTLHVVSATPSVRVSKAYAANGHARR
selected fasta
>non-ribosomal peptide synthetase [pipecolate incorporating enzyme]
ATGGCTTCCGACAGTCCCCGCCCAAGGCCGCTCAAACCGGCTTTCGCTGTTTCGCGGACG
CAGCGTCAGCGTCGCAGACTTGACGAGCGCGGCATCAGTCGCGCCGATCGGAACGGGCCA
CTTCCGGCGTCTTTCTCGCAGCAACGTCTATGGCTCATGCAGCAGGTCGCACCCGACAGC
AATTCCTATAATCTGCCGCTCGTGCAGCGGCTGCGGGGCGCCCTGGACACCGTGATCCTC
AGGCGCGCTCTCGGCCTCGTCGCAAGCCGCCACGAGGCGCTTCGGACCGTATTCGACGCG
GAGGACGGCGAGCCGCTCCAGCGGATCCAGCCCGCGGATGTCGTGCGCCTGCGCGAACTG
GACGCCCGGGACGAGGACCACGCCAGAGCGTTGGTCCGGCGGGAGACGGCCGAGCCGTTC
GACCTGCACGCCGGTCCTGTGATGAGAGCGTTGTTGGTACGACTCGCCGACGATGACCAC
GTGCTGGCGCTCACGGTGCATCACATCGCGGGCGACGGCTGGTCGCTGGCCATCCTGCGG
ATGGAGCTCTCGGCGCAGTACGCGCCGCTGCTTCGCGGTGCGGAGGCCGATCTGCCCGCA
CTCCCGTCGCAGTACGCGGACTTCGCCCAGTGGGAACGCAAGGCGTTGTCGGGCACCAAG
CTGCAAAAGCGGCTGGACTACTGGCAGGAGAACCTGCGGGACGCCCCGATGGTGCTGGGA
TTGCCGGCCGACCGGCCACGACCGCCGGTCGGCAGTTCGGACGCGGGCACGGTGGCCTGG
TGCCCGCCGACGGAATTGGTGACCGCGGCCAAAGAACTGAGCCGGTCGACGGGCACCACG
CTGTTCATGTCGCTGCTGGCCGCCTTCCAGGTGGTGCTGTCCCACTACGCGCGCACCGAT
GACGTCCTGGTCGGCACCCCGATCGCCAACCGCAATCACGCGGAGGTGGAGGGGCTGATC
GGCATGTTCGTGAACACGGTGGTGCTGCGCGGCGATCTGTCAGGTGATCCGACCTTCCGC
GAGCTCCTCCTGCGGACCCGTACGAACGCCATGGGCGCGTTCGCGAACGCCGAGCTGCCG
TTCGACCTCCTCGTCGAGAAGGTCGCACCGCAGCGCGACCTGTCGGTGAACCCGGTCGTG
CAGGTGCTCTTCCAGCTCATGCCGCTGGCGTCGAACACGTTTACGCTGCCGGGAATCGCG
GTCGAGCCGTTCGATATGAACCAGTTCTTCACCCGCATGGATCTGGAGTTCCATGTCTAC
GAGGATCCCGCCGGGGACAGGCTGACGGGCGAGGTCTGGTACAGCCGAGCGCTCTTCGAC
GGGCCTCGTATAGAACGAATGCTGGATCAGTTCACTCTCGTCCTGCGCAGCGTACTCGAC
AACCCGGACGTTCCGATCTCGCAGATTTCACTCGCGCCGGAGATCGGTACCGACCTGCCG
ACGGTCGAAGCGAACGAAACAGACCGAGACTTGCCGTTCGATTCGCTGCCGGAATTGCTG
GCGGACGCGGCAGCAAGAAACCCCGACGCGATCGCCGTCGTCGACGAACGGGTCACACTC
ACCTATGCCGAACTCGGTGGGCGGGCCAATAAGATGGCGCATCTGCTGCGACACAAAGGC
GTTCGCCCCGGCGAACTAGTCGGTCTTTGCGTCGACCGAGGCGCCGATATGATCCGTGGG
CATGCTCGGATTCTCAAAGCCGGCGCGGGCTATGTGCCCATCGACCCCGAGCATCCCATC
GAGCGCACCCGTTTCGGGTTGGACGATTCCAGCATATCCACGGGCATCGCTCAGGAGACG
TACCGGACTCGGTTCCCCGATGTCCGCGACATCATTCTCCCGGACGACCCCGGCCTCGAG
AATCAGCCCGCAAGCCCGCCCGATGTGACGACCGACCGCAACAGCCTGGCCTATGCGATT
TACACCTCCGGTTCCACGGGCCGTCCCAAGGCCGTGCTCATGCCCGGCATCTGCGTCGTC
AACCTGCTGCTGTGGCAGGAACGCACGATGGGTCGCGAACCGGCCAGTCGCACCGCCCAG
TTCATCACCGCGACCTTCGACTACTCGGTTCAGGAAATCTTCTCCGCGCTGCTCGGGGGC
ACGCTTGTCATTCCCCCCGACGACATACGGCTGGACCCCGCGCGACTCGCACAATGGATC
GACGACAGCCGTATCACGCGCATCTACGCACCCACCACGGTGCTGCGCGCGCTGGTCGAG
CACGTCGACCCGCACGGGCACGGGCTTGTCGACATTGCGTCACCTCTGCCAGGCGGCGAG
TCACTCGTGCTGGACGGCAAGTTACGAGAGTGTGCCCTGCACCGCCCGCATCTGCGGGTG
CACAACCACTATGGCCCGGCGGAGAGCCAACTCGTCACGGGCTACACACTGCCCGAGGAC
GTCTCCGCCTGGCCGTCCACGACCCCTATCGGGAAGCCGATCGACAACACGCGCATCCAC
CTTCTCGACGACGCGCTTCGTCCGTACCCGACGGCGTATGCGGCGCAGGTCTGCATATCG
GGGATCGGTCTGGCCCGCGGCTACCTGGCCCGGCCCGAACTGACCCGGCAGCGATTCATC
ACCGAAGGTACCGGCTCGGAGCCGAGGATGTACCTCTCCGGTGACCTGGCCCGGCGGCTG
CCGGACGGAAATCTCGAGTTTCTCGGGAGAATCGACGACCAGGTCAAGATCCGGGGCATC
CGGATCGAACTCGGCGAGATCGAGACGGCCCTGTCCGAACACGCGGCCATAACTCAGGCC
GCGGTGACCGTCCGAGAAGACGACCGCGGCGACAAACGGCTGGTCGCCTACGTGGTGCCC
CACTCGGATGCCGGGGACCTCGCCGTCGAATTGCGCGGTCATGTCGAGGCGCGGCTCCCC
TCTTACATGGTCCCGTCCGCGTTCATCGTCCTGGACAAGCTGCCGCTGACGACGAGCGGA
AAGACCGACCGGCGTGCGCTCCCCGCCCCGGAAAGCTGGTCACCGGGCCCCACCTCGCCA
GTCTCCCCGCGCAACGCGACCGAATCCACGGTTTGCGGGATCTACGCTGACGTGCTCGAG
GTGCAAACCGTCGGCGTGCACGACGATTTCTTCGCTCTCGGCGGCCACTCGCTGCTCGCC
TCCCGCGCCGTCTCGCGTATCCGTGCCGAGCTGGGCTGCGATCTACCGCTTCGTACGCTG
TTCGACGTCCGGACTCCCGCCTTGCTCGCCCAGGCCATCGGGTCGATGTCGTCGCGGGAC
ATGCCCGTGCTCGCGCCATCGCCGCGGACCACGCCCGCACCGATCTCGCTGGCCCAGCAG
CAGCTGCTCGGGATCAGTGATTCGCTGCTCGACCTGGGCGCATTTCCCGTCTGCCCGTAC
GGATTCCGGCTGCGCGGGGAGATCGACCGCACCGTACTCGACACCGCTCTGACCCGGATC
GTCGCGCGTCACGAGCCACTGCGAACAGGCTTCCGCGACGACGGCGACGGCTTCGTGCAG
ATCGTCCGCGAGCCCGCGCCGGTGAGGGCCGAGTTCATCGAGGTGACCGGGAAAGACACG
ACCGACCGTGAAGCGGCGGCGGCAGAGATCGCCAAGAACGAACTTGAACGTCCCTTCGAC
CTGGTCGACGGTATTCTGCTCCGCGCCGTTCTGCTGCGGCTGGAGCAAGACGACCACATC
CTCATCCTGATGTTGCACCACATCGCGGGCGACGGCTGGTCCTTCGACGTTCTGGTACGC
GAGCTGTCCGCGCTGTACGCCGAATGCCGCGTCCCCGTCGCGGGACTGACGGAAGTCGGC
ACGACATATTCGGACTTCGCCCGCTGGGAGCACGAGGCCCTGTCCGGGTCCATCCGCGAG
GAACACGACGCCTACTGGCGAGAGCACCTCAAGGGCGCTGTCGCACTGGAACTGCCCACC
GACAGGCCGCGAAAGCTTGCGGATCCGATCGGGAAATCCCTCGAGTGGACGGTTTCCCCG
GATGCGACAGCCGCAGCGCGGAGGCTCGCGCAGGCAGAGGGCGTGACCCTTTACGAAACC
ATGCTCGGAGCCTTCACGCTGGCCGCAGCCGGGTTGTCAGGCCTGGACGACATTCTGGTG
GCAACCCCTTTCGCCAATCGTGGCCGACCCGAGATCGACCACCTGATCGGCTTCTTCGCC
AAGGTTGCCGCCCTCCGTGTCGATCTCTCCGACGATCCGACGTTCCGCGAGGTCCTGCGA
CGCGTCCAGACCGCGGTCCTGGGTGCTCACGCGCACCAGGACCTCCCCTATGCGGCGATA
CAGGCCACGGCCACGGCCACGGCCACGGCCACGGCCACGGCCACGGCATCCGAACTCCCC
CCGCCGCTCGTGCAGTTCCAGCTGATCAGCTCGCTGACCTCGGATCTCGTCCTGCCTGGC
ACCACCATCGAGCGCTTCGGCATGGTCGAGGCCGATCTGGGGGTCGGGAACGGCGAACTC
GCCATCTGGCTCTTCGACGATGACAGCGCCCTGCACGGAACTGTCGTATTCGACGGATCC
CTATTCGACCCCGCGAGAATTCAGAGTCTGCTTTCCTCGGTCGAGTCGACGTTGCACGTT
GTCTCTGCCACCCCCTCCGTACGCGTATCCAAGGCATACGCAGCAAACGGCCACGCAAGG
AGATAG
[15] C39..332
[15] A521..922
[15] L-pipecolate687..792
[15] PCP1007..1074
[16] C1092..1389
[15] C115..996
[15] A1561..2766
[15] L-pipecolate2059..2376
[15] PCP3019..3222
[16] C3274..4167

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [521-922]  1.5e-92 PF00501
PF00501   AMP-binding
IPR001242 Condensation domain (Domain)
 [39-332]  2.50000000000001e-74 PF00668 [1092-1389]  3.5e-53 PF00668
PF00668   Condensation
IPR009081 Acyl carrier protein-like (Domain)
 [999-1076]  7.7e-25 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1000-1075]  4.70000326671387e-19 SSF47336
SSF47336   ACP_like
 [1010-1073]  1.9e-11 PF00550
PF00550   PP-binding
 [1007-1074]  PS50075
PS50075   ACP_DOMAIN
IPR010071 Amino acid adenylation domain (Domain)
 [521-922]  8.90000000000015e-111 TIGR01733
TIGR01733   AA-adenyl-dom
SignalP No significant hit
TMHMM No significant hit