close all open/close all

CDS information : Rapam_00140


close this sectionLocation

Organism
StrainNRRL 5491
Entry nameRapamycin
Contig
Start / Stop / Direction71,949 / 90,731 / + [in whole cluster]
71,949 / 90,731 / + [in contig]
Location71949..90731 [in whole cluster]
71949..90731 [in contig]
TypeCDS
Length18,783 bp (6,260 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase
Gene
Gene (GenBank)rapC
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[7644502] The biosynthetic gene cluster for the polyketide immunosuppressant rapamycin. (Proc Natl Acad Sci U S A. , 1995)
[8635756] Organization of the biosynthetic gene cluster for rapamycin in Streptomyces hygroscopicus: analysis of the enzymatic domains in the modular polyketide synthase. (Gene. , 1996)

close this sectionPKS/NRPS Module

11 malonyl-CoA
12 malonyl-CoA
13 methylmalonyl-CoA
14 malonyl-CoA
KS34..404
AT544..782
dh860..1007
KR1270..1446
ACP1534..1608
KS1630..1995
AT2131..2368
dh2447..2590
KR2855..3031
ACP3121..3195
KS3217..3585
AT3725..4028
DH4068..4229
ER4525..4830
KR4840..5016
ACP5113..5186
KS5220..5591
AT5760..6075
ACP6137..6207

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase]
MPEQDKVVEYLRWATAELHTTRAKLEALAAANTEPLAIVGMACRLPGGVSSPEDLWRLVE
SGTDAISDFPADRGWDVENLYDPDPDASGKSYCVQGGFLDSAGGFDASFFGISPREALAM
DPQQRLVLEVSWEAFERAGIEPGSLRGSDTGVFIGAYPGGYGAGAGADLEGYGTTSGPSV
LSGRVSYFFGLEGPAITVDTACSSSLVALHQAGYALRQGECSLALVGGVTVMATPDVFTE
FARQRGLATDGRSKAFADSADGAGFSEGIGVLLVERLSDAEAKGHQVLAVVRSSAVNQDG
ASNGLTAPNGPSQQRVIQTALSNAGLTTAEVDVVEGHGTGTTLGDPIEAQAVIATYGQDR
EQPLLLGSLKSNIGHTQAAAGVSGVIKMVMALRHALVPRTLHVDEPSRHVDWTAGAVELV
TENQPWPEIGRPRRAGVSSFGVSGTNAHVILESAPPTQAEDAAQPVEAPVMGSEPVPLVI
SAKTLPALNAHEDRLRAYLAASPGVDMRAVASTLAMTRSMFEHRGVLLGDGTVSGTAVSD
PRVVFVFPGQGSQRAGMGEELAAAFPVFARIHQQVWDLLDVPDLDVNETGYAQPALFALQ
VALFGLLESWGVRPDAVIGHSVGELAAAYVSGVWSLEDACTLVSARARLMQALPAGGVMV
AVPVSEDEARAVLGEGVEIAAVNGPSSVVLSGDEAAVLQAAEGLGKWTRLATSHAFHSAR
MEPMLEEFRAVAEGLTYRTPQVSMAVGDQVTTAEYWVRQVRDTVRFGEQVASYEDAVFVE
LGADRSLARLVDGVAMLHGDHEAQAAVGALAHLYVNGVSVEWSAVLGDVPVTRVLDLPTY
AFQHQRYWLEGTDRATAGGHPLLGSVVRLAEASGVLFTARVSRSGDLWLRDQTVLPATVF
VEMALAAADEVGCGLVEDLSVEALLLLPDDGAVEVQTWVGEPDEGGRRRLSVHARYGDGE
PWTCLATATLATTTGVAAAAVGWQAGGVWPPAGPVPVGTSAPSLRAVWRLGSDIFTEVAL
DDAHDATRFVRHPGLMTAALTTVGEETPAVWQGLTLHAGNPGELRVRLTSHDDGTLSAEA
TDSTGLPVLTARSLTLRTVPVYEPATSTDDLLTLTWAGIPTPQQTGLTVGAFEDLAADGD
VPVPEVAVFTALPDSDDPLEQTRKLTAQVLHTLQEWLGGERFSDSTLVVRTGTGLAAAGV
SGLMRSAQSEHPGRFVLVESDDALTQDQLAAAVGLDEPRLRVSDGRYEVPRLTRTHAEEP
EPERTWDPDGTVLITGGSGVLAGIAARHLVTERGVRHLLLLSRSAPDEALIGELGELGAR
VETAACDVSDPAALTQVLAGVSPEHPLTAVIHTAGVVDDGVVESLTVQRLETVLRPKADG
AWNLHELTRDADLAAFVMYSSAAGVLGSAGQGNYAAANAFLDALAEQRHAEGLPALAVAW
GLWEDASGLTAQLTDTDRDRIRRGGLRAISAEHGMGLFDSASRHSEPVLVAAPMEPVRDA
EVPALLRSLHRPIARRAAAAGGARWLAALAPAEREKALLKLVSDGAATVLGHADTSTIPA
TTAFKDLGINSLTAVELRNSLAKATELRLPATLVFDYPTPAALAARLDELFTGENPVPVR
GPVSAVAQDEPLAIVGMACRLPGGVSSPEDLWRLLESGTDAVSGFPTDRGWDVENLYDMA
GKSHRAEGGFLDAAAGFDAGFFGISPREALAMDPQQRLVLEVSWEAFERAGIEPGSVRGS
DTGVFMGAYPGGYGIGADLGGFGATASSVSVLSGRVSYFFGLEGPAFTVDTACSSSLVAL
HQAGYALRQGECSLALVGGVTVMATPQTFVEFSRQGGLASDGRCKAFADAADGTGWAEGV
GVLLVERLSDARRNGHQVLAVVRGSAVNQDGASNGLTAPNGPSQQRVIRAALSNAGLSTA
EVDVVEAHGTGTTLGDPIEAQALIATYGQDRDQPVLLGSVKSNLGHTQAAAGVSGVIKMV
MALQHGLVPRTLHVDEPSRHVDWSAGAVQLVTENQPWPDMGRARRAGVSSFGISGTNAHV
ILESAPPTQPADNAVIERAPEWVPLVISARTQSALTEHEGRLRAYLAASPGVDMRAVAST
LAMTRSVFEHRAVLLGDDTVTGTAVSDPRAVFVFPGQGSQRAGMGEELAAAFPVFARIHQ
QVWDLLDVPDLEVNETGYAQPALFAMQVALFGLLESWGVRPDAVIGHSVGELAAAYVSGV
WSLEDACTLVSARARLMQALPAGGVMVAVPVSEDEARAVLGEGVEIAAVNGPSSVVLSGD
EAAVLQAAEGLGKWTRLATSHAFHSARMEPMLEEFRAVAEGLTYRTPQVSMAVGDQVTTA
EYWVRQVRDTVRFGEQVASYEDAVFVELGADRSLARLVDGVAMLHGDHEIQAAIGALAHL
YVNGVTVDWPALLGDAPATRVLDLPTYAFQHQRYWLEGTDRATAGGHPLLGSAVRLAEAS
GVLFTARVSRSGDLWLRDQTVLPATVFVEMALAAADEAGCGLVEDLNVEALLLLPDDGAV
QVQTWVSEPDEAGRHRLSIHARYSDSEPWTRLATATLATRGTVSGWQAGEAWPPTGAVPV
ETGVPSLRGVWRRGNEVFAEVALDSTHDATTYALHPALLTAALTTAGEETPAAWQALTLH
ARNPAELRVRLISHDDGTLSVDATDSTGLPVLTVRSLTLRTVPVYEPATSTDDLLTLTWA
EIPAPQETGLTVGRFEDLVSDADVPVPEVAVFTALPDSSENPLEQTRVLTAQVLQAVQTW
LGGERFTDSTLVVRTGTRLAAAGVSGLMRSAQSEHPGRFVLVESDDDTLAPDQLAATVGL
DEPRLRVSGDRYEAPRLARVNASGSEPEAVWDPDGTVLITGGSGVLAGIAARHLVAERGV
RHLLLLSRSAPDEALINQLGELGARVETAACDVSDRAALAQVLAGVSPEHPLTAVIHTAG
VLDDGVVESLTAQRLDTVLRPKADGAWHLHELTRNTDLAAFVMYSSAAGVMGGGGQGNYA
AANAFLDALAEERRAEGLPAIRGGLGLWEDTSGLTTQLTDTDRDRIRRGGLRTITAEYGM
RLFDTASRHGNPILVAAPMDPVWDAEVPALLRSLHRPVARRAASTSDSSARWLAALAPAE
REDALLKLVRDSAALVLGHADASTIPAAAAFKDLGIDSLTAVELRNSLAKATGLRLPNTT
VFDYPTPAILATRLGELFTGENPAPVRPSVSVVGQDEPLAVVGMACRLPGGVSSPEDLWR
LVESGTDAISGFPADRGWDAESLFDPDPDASGKSYCVEGGFLDSAGSFDAGFFGISPREA
LAMDPQQRLIMEVSWEAFERAGIEPGSVRGTHRRLHGRVRGGYGAGADLGGFAATASATS
VLSGRVSYFFGLEGPAITVDTACSSSLVALHQAGYALRQGECSLALVGGVTVMATPQSFV
EFSRQRGLASDGRCKAFADSADGTGWAEGVGVLLVERLSDAQAKGHQVLAVVRSSAVNQD
GASNGLTAPNGPSQQRVIQAALSNAGLAAHEVDVVEAHGTGTTLGDPIEAQALIATYGQD
RERPLLLGSLKSNIGHAQAASGVSGVIKMVMALQHNTVPRTLHVDEPSRHVDWAAGAVEL
VRENQPWPGTDRPRRAGVSSFGVSGTNAHVILESAPPAQPAEEAQPVETPVVASDVLPLV
ISAKTQPALTEHEDRLRAYLAASPGADIRAVASTLAVTRSVFEHRAVLLGDDTVTGTAVT
DPRIVFVFPGQGWQWLGMGSALRDSSVVFAERMAECAAALREFVDWDLFTVLDDPAVVDR
VDVVQPASWAMMVSLAAVWQAAGVRPDAVIGHSQGEIAAACVAGAVSLRDAARIVTLRSQ
AIARGLAGRGAMASVALPAQDVELVDGAWIAAHNGPASTVIAGTPEAVDHVLTAHEAQGV
RVRRITVDYASHTPHVELIRDELLDITSDSSSQTPLVPWLSTVDGTWVDSPLDGEYWYRN
LREPVGFHPAVSQLQAQGDTVFVEVSASPVLLQAMDDDVVTVATLRRDDGDATRMLTALA
QAYVHGVTVDWPAILGTTTTRVLDLPTYAFQHQRYWLKSVDRAAADGHPLLGTVVALPGS
DGVVLTGRVSLATHTWLADHAVRGSVLLPGTAFVELVVRAADEVECDVVDELVIETPLLL
PQTGGVQLSVSVAEADESGHRTVTVFSQADNTDAWIRHVSATISTSDTPLSLPESDTWPP
AQAQPMNVADFYDRLMAEGYEYGPAFQGLQAAWRDGDTVYAEVALAEEQAQEAARYDVHP
ALLDAALHACTLNTPDAEEGVGLPFSWNHVQVHATGPATLRVAVTQEADGWSLRVADDTG
RPVATIGSLITRPVTADTLGSTTDDLLTLTWTVIPPPQETSLPMVRYEDLADGNMPVPDV
VVFTALPNSSENPLGPRPAGPADPLAQPDTDRQVLKPFQTWLPGTFTDSTLVVRTGTGLA
AAAVSGLMRSAQSEHPGRFILVESDDDTLTLRQLAATVGLDEPRLRINDGRYEAARLART
NTTPEDTPLTIPDSRAWLLEQPRSGTLQDLALVPTDTAEQPLRPGEVRIDVRAAGLNFRD
VVVALGMVNDNRPTGGEAAGVVLEVGPDVQDLAPGDRVFGVVGGSFGPAAIADRRMLAVI
PDGWSFTTAASVPVVFATAYYGLVDLAGLSEGESVLIHAAAGGVGMAATQIARHLGARIY
ATASTGKQHILREAGLEDTHIADSRTLSFQETFLNNTHGQGVDVVLNSLSGDFVDASLDL
LPRGGRFVEMGKTDIRDPHQVTADRPGTTYQAFDLMDAGPDRLREIITELLTLFTQGVLL
PLPVQAWDIRQARDAFSWMSRARHIGKIVLTIPRRPDPDGTILITGGSGVLAGILARHLA
AEHGARHLLLLSRTTPDQALIKELAELGAHVDTATCDVSDRAGLARVLAGVSPEHPLTAV
IHTAGALDDGVVESLTTQQLDTVLRPKADGAWHLHELTQNTDLAAFVMYSSAAGVIGGAG
QGNYAAANAFLDALAEQRRAEGLPALALAWGLWDDTSGLTSGLTDTDHDRIRRSGMRTIT
AEHGMRLFDGASRHGEPVLFAAAMSPLRGDVEVPALLRGLQTVKRPQSRTAARNEVGSQP
LSARLTGRTSVEQHRIMLELVLERRSVLGHSSADAIATDTSFKDLGMDSLTAIELRNRLV
AETGLQLPATMVFDYPTANALAAHLLGKLDIPPVQQRLEAPAPSTVTGPADPVADEPSAN
EPIAIVAMACRLPGGVSSPEGLWHLVESGTDAISGFPTDRGWDVEGLFDPDPDAAGKSYC
VQGGFLDTAADFDAPFFGISPREALGMDPQQRLLLETTWEAIERAQIDPKSLRGRDVGVY
VGGAAQGYGVGVDQQHDNGITGSSVSLLSGRVSYALGLEGPGVTVDTACSSSLVALHLAS
QALRQRECSLALVSGVSVMSSPAMFVEFSRQRGLSSDGRCKSFAASADGTIWSEGVGVLV
VERLSDARRLGHRVLATVRGSAVNSDGASNGLTAPNGTSQQRVIRQALANAGLTASDVDV
VEAHGTGTKLGDPIEAEAILATYGQERSAPAWLGSLKSNIGHAMAASGVLSVIKMVEAMA
HGSLPRTLHVDAPSPHVDWTSGSVALLTEHQPWPDDTKLRRAGVSSFGLSGTNAHVVLEQ
YQAPAPPVTPVTPAPPVTPVTPVTPNEPGPLPWVLSAQSPKALREQAGRLYASLAGDSEW
NSLDIGYSLATTRSDFAHRAVAVGSGREDFLRALSKLADGAPWPGLTTATATAKARRVAF
LFDGQGTQRLGMGKELYDSYPAFARAWDTVSAGFDKHLDHSLTDVCFGEGGSTTAGLVDD
TLYAQAGIFAMEAALFGLLEDWGVRPDFVAGHSIGEATAAYASGMLSLENVTTLIVARGR
ALRTTPPGAMVALRAGEEEVREFLSRTGAALDLAAVNSPEAVVVSGEPEPVADFEAAWTA
SGREARKLKVRHAFHSRHVEAVLDEFRTALESLKFRAPALPVVSTVTGRLIDQDEMGTPE
YWLRQVRRPVRFQDAVRELAEQGVGTFVEVGPSGALASAGVECLGGDASFHAVLRPRSPE
DVCLMTAIAELHAGGTAIDWAKVLSGGRAVDLPVYPFQHQSYWLAPAAPDATAVAPVVEE
EGGEYDEPSYADEPRTMLELVHMEVASLLGMADPGVILDDSSFLELGFDSLSAVRLRNRL
SKATGLDLPSTLLFEHPTSAELAAHLDALLDSDIDAAGVYALLEEINELDAEAVDMTAAE
HKAISELLEQLSAKWRTRNE
selected fasta
>polyketide synthase [polyketide synthase]
ATGCCTGAGCAAGACAAAGTGGTCGAATATCTTCGCTGGGCGACTGCGGAGTTGCACACC
ACCCGCGCCAAACTGGAAGCACTTGCCGCCGCCAACACCGAGCCGTTGGCGATTGTGGGT
ATGGCGTGCCGTCTGCCGGGTGGGGTGTCGTCGCCGGAGGATCTGTGGCGCTTGGTCGAG
TCGGGTACGGACGCGATTTCCGACTTCCCCGCCGACCGTGGCTGGGACGTCGAGAACCTG
TACGACCCTGATCCGGACGCGTCCGGGAAGTCGTACTGCGTGCAGGGTGGCTTCCTGGAC
TCCGCAGGCGGTTTCGACGCCTCGTTCTTCGGGATCAGCCCGCGTGAGGCGTTGGCGATG
GATCCACAGCAGCGACTGGTCCTGGAGGTGTCCTGGGAGGCGTTCGAACGGGCCGGGATC
GAGCCCGGTTCCCTTCGCGGCAGCGACACCGGCGTCTTCATAGGCGCTTACCCAGGCGGC
TACGGCGCCGGTGCCGGTGCTGACCTTGAGGGTTATGGCACCACATCCGGTCCCAGCGTG
CTCTCCGGCCGGGTGTCGTACTTCTTCGGCCTCGAAGGCCCCGCCATCACGGTGGACACC
GCATGTTCTTCGTCGCTGGTGGCGTTGCATCAGGCGGGGTACGCCCTGCGGCAGGGGGAA
TGTTCCCTGGCCCTGGTCGGCGGTGTCACCGTGATGGCCACGCCGGACGTCTTCACCGAA
TTCGCCCGGCAGCGTGGCCTGGCCACCGACGGCCGCAGCAAAGCCTTCGCGGACAGTGCG
GACGGTGCCGGATTCTCCGAGGGCATCGGTGTGCTGCTGGTGGAGCGTTTGTCGGACGCT
GAGGCCAAGGGTCACCAGGTGCTGGCGGTGGTCCGCAGTTCGGCGGTCAACCAGGACGGC
GCGTCCAACGGCCTGACCGCGCCGAACGGCCCCTCCCAGCAGCGAGTGATCCAGACCGCG
CTCAGCAACGCCGGTTTGACCACAGCCGAGGTGGACGTGGTCGAGGGCCACGGCACGGGT
ACGACGCTGGGCGACCCGATCGAAGCCCAAGCCGTGATCGCCACCTACGGCCAGGACCGT
GAACAGCCCCTGCTGCTCGGATCGCTGAAATCAAACATCGGTCATACCCAGGCCGCCGCT
GGCGTATCGGGTGTCATCAAGATGGTGATGGCCCTGCGGCATGCTTTGGTGCCGCGTACG
TTGCATGTGGATGAGCCGTCGCGGCATGTGGACTGGACGGCGGGTGCGGTTGAGCTGGTG
ACGGAAAACCAGCCGTGGCCGGAGATTGGCCGGCCGCGCCGGGCAGGCGTGTCCTCCTTT
GGAGTCAGTGGCACTAATGCCCACGTCATCCTGGAGAGCGCACCCCCCACGCAGGCTGAA
GACGCCGCCCAGCCCGTAGAAGCGCCGGTGATGGGCTCGGAGCCGGTGCCTCTGGTGATT
TCCGCCAAGACGCTACCGGCCCTGAACGCACACGAGGACCGGCTGCGCGCGTATCTGGCG
GCGTCGCCCGGGGTGGATATGCGGGCTGTCGCGTCAACACTGGCGATGACACGGTCGATG
TTCGAACACCGTGGGGTGCTGCTGGGTGACGGCACTGTCTCCGGTACCGCGGTGTCTGAT
CCGCGGGTGGTGTTCGTCTTCCCGGGTCAGGGGTCGCAGCGTGCTGGTATGGGTGAGGAA
CTGGCCGCCGCGTTTCCCGTCTTCGCGCGGATCCATCAGCAGGTGTGGGATCTGCTGGAT
GTGCCCGATCTCGATGTGAATGAGACCGGCTATGCCCAGCCGGCCCTGTTCGCTTTGCAG
GTGGCTCTGTTCGGGTTGCTGGAATCGTGGGGTGTACGGCCGGACGCGGTGATCGGCCAT
TCGGTGGGTGAGCTTGCGGCTGCGTATGTGTCCGGGGTGTGGTCGTTGGAGGATGCCTGC
ACTTTGGTGTCGGCGCGGGCTCGTCTGATGCAGGCTCTGCCCGCGGGTGGGGTGATGGTC
GCTGTCCCGGTCTCGGAGGATGAGGCCCGGGCCGTGCTGGGTGAGGGTGTGGAGATCGCC
GCGGTCAACGGCCCGTCGTCGGTGGTTCTCTCCGGTGATGAGGCCGCCGTGCTGCAGGCC
GCGGAGGGGCTGGGGAAGTGGACGCGGCTGGCGACCAGCCACGCGTTCCATTCCGCCCGT
ATGGAACCCATGCTGGAGGAGTTCCGGGCGGTCGCCGAAGGCCTGACCTACCGGACGCCG
CAGGTCTCCATGGCCGTTGGTGATCAGGTGACCACCGCTGAGTACTGGGTGCGGCAGGTC
CGGGACACGGTCCGGTTCGGCGAGCAGGTGGCCTCGTACGAGGACGCCGTGTTCGTCGAG
CTGGGTGCCGACCGGTCACTGGCCCGCCTGGTCGACGGTGTCGCGATGCTGCACGGTGAC
CATGAGGCGCAGGCCGCTGTCGGTGCCCTGGCTCACCTGTACGTGAACGGCGTGAGTGTC
GAGTGGTCCGCGGTGCTGGGTGATGTCCCGGTAACCCGGGTGCTGGATCTTCCGACGTAC
GCCTTCCAGCACCAGCGGTACTGGCTTGAGGGCACGGACCGGGCGACTGCGGGTGGTCAT
CCGTTGCTGGGTTCGGTGGTGCGGCTGGCCGAGGCCAGTGGGGTGTTGTTCACTGCCCGG
GTTTCCCGGAGCGGTGATCTGTGGCTGCGGGACCAGACGGTTCTGCCCGCGACGGTGTTC
GTGGAGATGGCGCTGGCAGCGGCGGACGAGGTCGGCTGCGGTCTGGTTGAGGATCTGAGT
GTGGAAGCGTTGCTGCTGCTTCCCGATGATGGCGCCGTCGAGGTACAGACCTGGGTGGGC
GAACCGGATGAGGGCGGTCGGCGCCGGCTCAGTGTCCACGCCCGTTACGGTGACGGCGAG
CCCTGGACCTGCTTGGCCACCGCAACCCTGGCCACCACTACGGGTGTGGCCGCTGCCGCG
GTCGGCTGGCAGGCCGGTGGGGTGTGGCCACCGGCCGGTCCGGTCCCGGTCGGGACATCG
GCACCCTCACTGCGGGCGGTGTGGCGCCTGGGCAGCGACATCTTCACCGAGGTGGCCCTG
GACGATGCCCATGATGCCACCAGGTTTGTGCGTCATCCCGGCCTGATGACCGCCGCGCTC
ACCACCGTAGGCGAGGAGACTCCCGCCGTGTGGCAGGGCCTGACCCTGCACGCCGGCAAT
CCCGGCGAGCTGCGCGTCCGCCTCACCTCACACGATGACGGCACCCTGTCGGCAGAGGCC
ACCGACAGCACAGGCCTCCCCGTCCTGACCGCCCGCTCGCTCACCCTGCGCACCGTCCCC
GTATACGAACCGGCCACCAGCACCGACGACCTGCTCACCCTGACCTGGGCAGGAATCCCC
ACCCCCCAGCAGACCGGCCTGACGGTGGGTGCGTTTGAAGACCTGGCGGCGGACGGCGAT
GTGCCGGTACCCGAGGTGGCGGTCTTCACCGCACTCCCCGACAGCGACGATCCGCTGGAG
CAAACACGAAAGCTGACCGCTCAGGTCCTCCACACACTCCAGGAGTGGCTTGGCGGGGAG
CGCTTCAGCGACAGCACGCTGGTGGTGCGGACCGGCACCGGGTTGGCCGCTGCTGGGGTG
TCGGGGTTGATGCGCTCGGCCCAGTCCGAACACCCCGGCCGGTTCGTCCTGGTCGAAAGC
GACGACGCCCTCACCCAGGATCAGCTGGCGGCGGCGGTCGGACTGGATGAGCCGCGGCTG
CGGGTCAGCGACGGCCGGTACGAAGTACCACGGCTGACCCGCACACATGCCGAAGAGCCT
GAGCCTGAAAGGACGTGGGATCCGGATGGCACGGTCCTGATCACGGGCGGTTCAGGTGTG
CTGGCGGGGATCGCCGCCCGGCACCTGGTGACCGAACGCGGCGTGCGTCATCTCCTGCTG
CTGTCCCGCAGCGCCCCGGATGAGGCGCTGATCGGCGAGCTTGGTGAACTGGGGGCCCGG
GTCGAGACAGCGGCCTGTGACGTGTCCGATCCTGCCGCGCTGACGCAGGTGCTGGCGGGT
GTCTCGCCGGAGCATCCCCTGACGGCCGTGATTCACACCGCGGGCGTGGTGGATGACGGT
GTTGTGGAGTCTTTGACCGTGCAGCGGCTGGAGACGGTACTGCGGCCCAAGGCCGACGGT
GCGTGGAACCTGCACGAGCTCACCCGGGATGCCGACCTGGCCGCGTTCGTCATGTATTCC
TCCGCCGCCGGTGTGCTCGGTAGTGCGGGGCAGGGCAACTACGCGGCGGCCAATGCGTTC
CTGGACGCGCTGGCTGAGCAGCGTCACGCTGAGGGTCTGCCCGCACTCGCGGTGGCCTGG
GGTCTGTGGGAGGACGCCAGTGGCCTGACCGCGCAACTGACCGACACGGACCGTGACCGG
ATCCGGCGCGGTGGCCTGCGGGCCATCTCCGCCGAGCACGGGATGGGGCTGTTCGACAGC
GCGTCACGCCACAGTGAACCGGTTCTGGTGGCCGCGCCGATGGAGCCGGTACGGGACGCG
GAAGTCCCGGCATTGCTGCGGTCGTTGCACCGCCCGATTGCTCGGCGGGCCGCTGCCGCC
GGTGGAGCGCGGTGGCTGGCCGCCCTGGCACCGGCCGAGCGGGAGAAGGCACTGCTGAAG
CTGGTGTCTGACGGCGCCGCGACGGTTCTGGGACACGCCGACACCAGCACGATTCCGGCA
ACCACGGCGTTCAAGGATCTGGGCATCAATTCGCTGACCGCGGTGGAACTGCGCAACAGC
CTGGCGAAGGCCACGGAGCTGCGGCTGCCCGCCACGCTGGTGTTCGACTACCCCACCCCG
GCCGCCTTGGCTGCCCGGTTGGACGAGTTGTTCACCGGCGAGAACCCCGTACCGGTACGC
GGGCCGGTGTCGGCGGTGGCGCAGGACGAGCCGCTGGCGATCGTGGGAATGGCCTGCCGC
CTACCCGGTGGAGTCTCGTCGCCTGAGGATCTGTGGCGTCTCCTGGAGTCGGGTACAGAT
GCGGTCTCCGGTTTCCCCACCGACCGTGGCTGGGACGTCGAGAACCTGTACGACATGGCT
GGAAAATCGCACCGTGCTGAGGGTGGCTTCCTGGATGCCGCGGCTGGCTTTGATGCCGGA
TTCTTCGGGATCAGTCCGCGTGAGGCGTTGGCGATGGATCCGCAGCAGCGGCTGGTGCTG
GAGGTGTCCTGGGAGGCGTTCGAGCGGGCCGGGATCGAGCCCGGTTCCGTACGCGGCAGC
GATACCGGCGTTTTCATGGGTGCGTACCCCGGTGGCTACGGCATCGGTGCCGACCTCGGC
GGCTTCGGGGCCACCGCCAGTTCGGTCAGTGTCCTGTCCGGCCGGGTGTCGTACTTCTTC
GGCCTCGAGGGTCCCGCGTTCACAGTCGACACGGCCTGCTCGTCATCGTTGGTGGCGTTG
CATCAGGCGGGGTATGCCCTCCGGCAGGGAGAGTGTTCGCTGGCCCTGGTCGGCGGTGTC
ACTGTGATGGCCACGCCACAGACTTTCGTGGAGTTCTCCCGCCAGGGCGGCCTGGCCTCC
GACGGCCGCTGCAAAGCGTTCGCCGACGCCGCGGACGGCACGGGATGGGCTGAAGGTGTC
GGTGTCCTGCTCGTAGAGCGACTCTCCGATGCCCGCCGTAACGGTCACCAGGTGTTGGCG
GTGGTGCGTGGATCAGCGGTGAACCAGGACGGTGCGTCGAACGGTCTGACCGCGCCGAAT
GGTCCTTCGCAGCAGCGGGTGATCCGGGCCGCTCTCAGCAACGCGGGTCTGAGCACGGCT
GAGGTGGATGTGGTCGAGGCGCACGGCACGGGCACAACGCTGGGTGACCCGATCGAGGCC
CAGGCGCTGATCGCTACCTATGGCCAGGACCGTGACCAGCCTGTGCTGCTGGGTTCGGTG
AAGTCGAACCTGGGTCATACGCAGGCCGCTGCGGGTGTGTCCGGTGTCATCAAGATGGTG
ATGGCCCTGCAACACGGTCTGGTGCCGCGCACGTTGCATGTCGATGAGCCGTCACGGCAT
GTGGACTGGTCGGCGGGCGCGGTGCAGCTCGTGACGGAGAACCAGCCGTGGCCGGATATG
GGCCGAGCGCGCCGGGCAGGCGTGTCGTCCTTCGGGATCAGTGGCACCAACGCCCACGTC
ATCCTGGAAAGCGCACCCCCCACTCAGCCTGCGGACAACGCGGTGATCGAGCGGGCACCG
GAGTGGGTGCCGTTGGTGATTTCGGCCAGGACCCAGTCGGCTTTGACTGAGCACGAGGGC
CGGTTGCGTGCGTATCTGGCGGCGTCGCCCGGGGTGGATATGCGGGCTGTGGCATCGACG
CTGGCGATGACACGGTCGGTGTTCGAGCACCGTGCCGTGCTGCTGGGAGATGACACCGTC
ACCGGCACCGCTGTGTCTGACCCTCGGGCGGTGTTCGTCTTCCCGGGACAGGGGTCGCAG
CGTGCTGGCATGGGTGAGGAACTGGCCGCCGCGTTCCCCGTCTTCGCGCGGATCCATCAG
CAGGTGTGGGACCTGCTCGATGTGCCCGATCTGGAGGTGAACGAGACCGGTTACGCCCAG
CCGGCCCTGTTCGCAATGCAGGTGGCTCTGTTCGGGCTGCTGGAATCGTGGGGTGTACGA
CCGGACGCGGTGATCGGCCATTCGGTGGGTGAGCTTGCGGCTGCGTATGTGTCCGGGGTG
TGGTCGTTGGAGGATGCCTGCACTTTGGTGTCGGCGCGGGCTCGTCTGATGCAGGCTCTG
CCCGCGGGTGGGGTGATGGTCGCTGTCCCGGTCTCGGAGGATGAGGCCCGGGCCGTGCTG
GGTGAGGGTGTGGAGATCGCCGCGGTCAACGGCCCGTCGTCGGTGGTTCTCTCCGGTGAT
GAGGCCGCCGTGCTGCAGGCCGCGGAGGGGCTGGGGAAGTGGACGCGGCTGGCGACCAGC
CACGCGTTCCATTCCGCCCGTATGGAACCCATGCTGGAGGAGTTCCGGGCGGTCGCCGAA
GGCCTGACCTACCGGACGCCGCAGGTCTCCATGGCCGTTGGTGATCAGGTGACCACCGCT
GAGTACTGGGTGCGGCAGGTCCGGGACACGGTCCGGTTCGGCGAGCAGGTGGCCTCGTAC
GAGGACGCCGTGTTCGTCGAGCTGGGTGCCGACCGGTCACTGGCCCGCCTGGTCGACGGT
GTCGCGATGCTGCACGGCGACCACGAAATCCAGGCCGCGATCGGCGCCCTGGCCCACCTG
TATGTCAACGGCGTCACGGTCGACTGGCCCGCGCTCCTGGGCGATGCTCCGGCAACACGG
GTGCTGGACCTTCCGACATACGCCTTCCAGCACCAGCGCTACTGGCTCGAGGGCACGGAC
CGGGCGACTGCGGGTGGCCATCCGTTGCTGGGTTCGGCGGTGCGGCTGGCCGAGGCCAGC
GGGGTGTTGTTCACTGCCCGGGTTTCCCGGAGCGGCGATCTGTGGCTGCGGGACCAGACG
GTTCTGCCCGCGACGGTGTTCGTGGAGATGGCGCTGGCAGCGGCGGACGAGGCCGGCTGC
GGTCTGGTTGAGGACCTGAACGTGGAAGCGTTGCTGCTGCTTCCTGACGATGGCGCCGTC
CAGGTACAGACCTGGGTGAGCGAACCGGACGAGGCCGGTCGCCACCGGCTCAGTATCCAC
GCCCGTTACAGCGACAGCGAGCCCTGGACACGCTTGGCCACCGCAACCCTCGCCACCAGG
GGAACGGTATCCGGCTGGCAGGCCGGGGAGGCGTGGCCGCCGACCGGTGCGGTCCCGGTC
GAGACCGGAGTACCGTCACTGCGCGGGGTGTGGCGCCGAGGCAACGAAGTGTTCGCCGAG
GTCGCCCTGGACAGCACCCACGACGCCACCACATATGCCCTGCACCCTGCCCTCCTGACC
GCCGCCCTCACCACCGCCGGTGAGGAAACCCCCGCCGCGTGGCAGGCGCTGACCCTGCAC
GCCCGCAACCCTGCCGAGCTGCGCGTCCGCCTCATCTCACACGATGACGGCACCCTGTCC
GTGGACGCCACCGACAGCACAGGCCTCCCCGTCCTGACCGTCCGCTCCCTCACCCTGCGC
ACCGTCCCCGTCTACGAACCTGCCACCAGCACCGACGACCTGCTCACCCTGACCTGGGCG
GAGATCCCGGCCCCTCAGGAAACCGGCCTGACGGTCGGCCGGTTCGAGGACCTGGTGTCG
GACGCTGATGTGCCGGTACCCGAGGTGGCGGTCTTCACCGCACTCCCCGACAGCAGCGAG
AACCCGCTGGAACAGACCCGCGTACTGACCGCTCAGGTCCTCCAGGCAGTCCAGACCTGG
CTTGGCGGGGAACGTTTCACCGACAGCACGCTGGTCGTGCGGACCGGCACCCGGTTGGCC
GCCGCTGGGGTGTCGGGGTTGATGCGATCGGCTCAATCGGAACACCCCGGCCGGTTCGTC
CTGGTCGAGAGCGACGACGACACGCTCGCCCCGGACCAGTTGGCCGCCACCGTCGGGCTC
GACGAGCCGCGGCTGCGGGTCAGCGGCGACCGGTACGAGGCACCGCGACTGGCTCGTGTG
AACGCCAGTGGGTCTGAGCCTGAAGCGGTTTGGGATCCGGATGGCACGGTTCTGATCACC
GGTGGTTCGGGTGTGCTGGCGGGGATCGCCGCCCGGCACCTGGTGGCCGAACGCGGCGTG
CGTCATCTGCTGCTGCTGTCCCGCAGCGCCCCGGACGAGGCACTGATCAACCAACTCGGC
GAACTGGGCGCCCGGGTCGAGACAGCGGCCTGTGACGTGTCCGATCGTGCCGCGCTGGCC
CAGGTGCTGGCGGGTGTGTCACCGGAGCACCCCCTGACGGCAGTGATTCACACCGCGGGC
GTACTCGATGACGGTGTTGTCGAGTCCCTGACCGCGCAGCGGCTCGACACGGTACTGCGG
CCCAAGGCCGACGGCGCCTGGCATCTGCACGAACTCACCCGCAACACCGACCTGGCCGCC
TTCGTCATGTACTCCTCCGCCGCCGGTGTCATGGGCGGTGGGGGGCAAGGTAACTACGCG
GCGGCAAACGCGTTCCTGGACGCGCTCGCCGAAGAACGCCGCGCCGAGGGCCTGCCCGCA
ATTCGCGGTGGCCTGGGTCTGTGGGAGGACACCAGTGGCCTGACCACGCAACTGACCGAC
ACGGACCGTGACCGGATCCGGCGCGGTGGCCTGCGGACTATCACCGCCGAGTACGGGATG
CGGCTGTTCGACACCGCATCACGCCATGGCAACCCGATTCTGGTCGCCGCACCGATGGAC
CCGGTTTGGGACGCGGAAGTCCCCGCGCTCCTCCGCTCGTTGCATCGTCCCGTCGCCCGG
CGGGCCGCCTCTACCAGCGACTCGTCAGCGCGGTGGCTGGCGGCCCTGGCACCGGCCGAG
CGGGAAGACGCACTGCTGAAGCTGGTGCGTGACAGCGCCGCTCTGGTCCTGGGACACGCT
GACGCCAGCACCATCCCCGCAGCCGCCGCATTCAAGGATCTGGGTATCGATTCGCTGACC
GCGGTGGAACTGCGCAACAGCCTGGCGAAAGCCACAGGGCTGCGGCTGCCCAACACGACG
GTGTTCGACTACCCCACCCCGGCCATCCTGGCCACCCGGCTGGGTGAGCTGTTCACCGGC
GAGAACCCTGCACCGGTACGCCCGTCGGTGTCGGTGGTGGGGCAGGACGAGCCGCTGGCG
GTCGTGGGTATGGCCTGCCGTCTGCCCGGCGGGGTGTCGTCGCCTGAGGATCTGTGGCGC
CTTGTGGAGTCGGGTACGGATGCGATTTCCGGTTTCCCCGCCGACCGTGGGTGGGACGCG
GAGAGCCTGTTCGATCCGGACCCGGACGCGTCGGGCAAGTCGTACTGCGTAGAGGGCGGC
TTCCTCGACAGCGCAGGCAGCTTCGACGCCGGATTCTTCGGCATCAGCCCACGCGAGGCT
CTGGCGATGGACCCGCAGCAGCGGCTGATCATGGAGGTGTCCTGGGAGGCCTTCGAGCGG
GCCGGGATCGAGCCCGGTTCCGTGCGCGGCACACACCGGCGTCTTCATGGGCGCGTACGC
GGTGGCTACGGTGCCGGTGCTGACCTCGGCGGCTTCGCGGCCACCGCCAGCGCGACCAGT
GTCCTGTCCGGCCGGGTGTCGTACTTCTTCGGCCTCGAAGGCCCCGCCATCACAGTCGAC
ACAGCCTGCTCGTCATCACTGGTGGCACTGCACCAGGCCGGGTATGCCCTCCGGCAGGGA
GAGTGTTCCCTGGCCCTGGTCGGCGGCGTCACCGTGATGGCCACACCACAAAGCTTCGTG
GAATTCTCCCGCCAGCGTGGTCTGGCCTCCGATGGCCGGTGCAAGGCGTTCGCAGACAGC
GCGGACGGCACGGGATGGGCTGAAGGCGTTGGTGTGCTGCTGGTAGAGCGGCTTTCCGAC
GCCCAGGCCAAGGGCCATCAGGTGTTGGCGGTGGTCCGTAGCTCGGCGGTCAACCAGGAC
GGCGCGTCCAACGGTCTGACCGCGCCGAACGGTCCTTCGCAGCAGCGGGTGATCCAAGCC
GCTCTCAGTAACGCCGGCCTCGCCGCGCACGAGGTGGATGTGGTCGAGGCCCACGGCACG
GGCACGACGCTGGGCGACCCGATCGAGGCCCAGGCGCTGATCGCCACTTACGGTCAGGAC
CGGGAACGGCCCCTGCTGCTGGGTTCGCTGAAGTCGAACATCGGTCATGCTCAGGCCGCC
TCGGGCGTGTCGGGTGTCATCAAGATGGTCATGGCCCTGCAGCACAACACGGTTCCCCGC
ACCCTGCACGTGGATGAGCCGTCGCGGCACGTGGACTGGGCGGCGGGTGCGGTTGAGCTG
GTGAGGGAGAACCAGCCCTGGCCCGGCACCGACCGGCCCCGTCGGGCGGGCGTGTCGTCC
TTCGGAGTCAGCGGCACCAACGCCCACGTCATCCTGGAGAGCGCACCCCCCGCTCAGCCC
GCGGAGGAGGCGCAGCCTGTTGAGACGCCGGTGGTGGCCTCGGATGTGCTGCCGCTGGTG
ATATCGGCCAAGACCCAGCCCGCCCTGACCGAACACGAAGACCGGCTGCGCGCCTACCTG
GCGGCGTCGCCCGGGGCGGATATACGGGCTGTGGCATCGACGCTGGCGGTGACACGGTCG
GTGTTCGAGCACCGCGCCGTACTCCTTGGAGATGACACCGTCACCGGCACCGCGGTGACC
GACCCCAGGATCGTGTTTGTCTTTCCCGGGCAGGGGTGGCAGTGGCTGGGGATGGGCAGT
GCACTGCGCGATTCGTCGGTGGTGTTCGCCGAGCGGATGGCCGAGTGTGCGGCGGCGTTG
CGCGAGTTCGTGGACTGGGATCTGTTCACGGTTCTGGATGATCCGGCGGTGGTGGACCGG
GTTGATGTGGTCCAGCCCGCTTCCTGGGCGATGATGGTTTCCCTGGCCGCGGTGTGGCAG
GCGGCCGGTGTGCGGCCGGATGCGGTGATCGGCCATTCGCAGGGTGAGATCGCCGCAGCT
TGTGTGGCGGGTGCGGTGTCACTACGCGATGCCGCCCGGATCGTGACCTTGCGCAGCCAG
GCGATCGCCCGGGGCCTGGCGGGCCGGGGCGCGATGGCATCCGTCGCCCTGCCCGCGCAG
GATGTCGAGCTGGTCGACGGGGCCTGGATCGCCGCCCACAACGGGCCCGCCTCCACCGTG
ATCGCGGGCACCCCGGAAGCGGTCGACCATGTCCTCACCGCTCATGAGGCACAAGGGGTG
CGGGTGCGGCGGATCACCGTCGACTATGCCTCGCACACCCCGCACGTCGAGCTGATCCGC
GACGAACTACTCGACATCACTAGCGACAGCAGCTCGCAGACCCCGCTCGTGCCGTGGCTG
TCGACCGTGGACGGCACCTGGGTCGACAGCCCGCTGGACGGGGAGTACTGGTACCGGAAC
CTGCGTGAACCGGTCGGTTTCCACCCCGCCGTCAGCCAGTTGCAGGCCCAGGGCGACACC
GTGTTCGTCGAGGTCAGCGCCAGCCCGGTGTTGTTGCAGGCGATGGACGACGATGTCGTC
ACGGTTGCCACGCTGCGTCGTGACGACGGCGACGCCACCCGGATGCTCACCGCCCTGGCA
CAGGCCTATGTCCACGGCGTCACCGTCGACTGGCCCGCCATCCTCGGCACCACCACAACC
CGGGTACTGGACCTTCCGACCTACGCCTTCCAACACCAGCGGTACTGGCTCAAGAGCGTG
GACCGGGCGGCTGCCGACGGTCATCCACTGCTGGGCACCGTAGTGGCACTGCCCGGCTCC
GACGGTGTGGTGCTCACCGGGCGGGTGTCGCTGGCCACCCATACATGGCTGGCCGATCAC
GCGGTCCGGGGCAGTGTCCTGCTCCCCGGGACCGCATTTGTGGAACTGGTCGTCCGCGCC
GCCGACGAGGTCGAGTGCGACGTCGTTGACGAGTTGGTGATCGAAACCCCGCTCCTGCTG
CCGCAGACCGGAGGCGTCCAACTGTCCGTGTCCGTCGCCGAGGCCGACGAGTCCGGACAC
CGCACGGTGACGGTCTTCTCCCAGGCGGACAACACGGACGCATGGATCCGGCACGTTTCC
GCCACTATCAGCACCTCTGACACACCCCTCTCGCTGCCGGAGTCTGACACCTGGCCGCCA
GCCCAGGCCCAGCCGATGAACGTGGCCGACTTCTACGACCGGCTGATGGCAGAAGGCTAC
GAGTACGGTCCCGCCTTCCAAGGTCTGCAGGCTGCGTGGCGTGACGGGGACACCGTCTAC
GCCGAGGTTGCTCTCGCCGAGGAGCAGGCGCAGGAGGCGGCACGATACGACGTGCACCCG
GCCCTGCTCGATGCGGCCCTGCACGCCTGCACCCTGAACACACCCGACGCCGAGGAGGGT
GTGGGGCTGCCGTTCTCCTGGAACCACGTCCAGGTCCATGCCACTGGCCCGGCCACGCTG
CGGGTCGCGGTGACACAGGAAGCCGACGGCTGGAGTCTGCGGGTCGCCGACGACACCGGC
AGGCCCGTAGCCACCATCGGCTCCCTCATCACCCGGCCGGTAACCGCCGACACACTCGGC
TCCACCACGGACGACCTGCTCACTCTGACATGGACGGTAATCCCGCCCCCCCAGGAGACC
AGCCTGCCCATGGTCAGGTACGAAGACCTGGCGGACGGCAACATGCCGGTACCCGACGTG
GTGGTCTTCACCGCACTCCCCAACAGCAGCGAGAACCCACTGGGTCCGCGGCCCGCTGGA
CCCGCGGACCCACTGGCACAGCCCGACACTGACCGCCAGGTCCTCAAACCGTTCCAGACC
TGGCTGCCGGGAACGTTCACCGACAGCACGCTGGTCGTGCGGACCGGCACCGGGTTGGCC
GCCGCCGCCGTGTCGGGGTTGATGCGGTCGGCCCAGTCCGAACACCCCGGCCGGTTCATC
CTGGTCGAAAGCGACGACGACACCCTCACCCTCCGCCAACTGGCCGCCACCGTCGGACTG
GACGAGCCACGGCTGCGGATCAACGACGGCCGGTACGAGGCAGCACGACTGGCCCGGACC
AACACCACCCCCGAAGACACCCCGCTGACGATCCCCGACAGTCGTGCCTGGCTGCTGGAA
CAACCCCGCAGCGGAACCCTGCAAGACCTCGCCCTGGTACCCACCGACACCGCCGAACAG
CCCCTGCGACCCGGCGAAGTACGCATAGACGTACGCGCCGCAGGCCTGAACTTCCGCGAC
GTCGTCGTGGCCCTCGGCATGGTCAATGACAACCGGCCGACGGGCGGCGAAGCGGCCGGC
GTCGTGCTCGAGGTCGGCCCCGATGTACAGGATCTGGCCCCGGGAGACCGCGTCTTCGGC
GTGGTGGGAGGCTCATTCGGGCCGGCCGCGATCGCCGACCGTCGAATGCTCGCCGTGATT
CCTGATGGCTGGTCGTTCACTACGGCGGCGTCCGTCCCGGTTGTGTTCGCCACCGCGTAC
TACGGGCTGGTGGATCTGGCCGGGCTGAGTGAGGGTGAGTCCGTGCTGATCCACGCCGCC
GCGGGTGGTGTCGGCATGGCAGCCACCCAGATCGCCCGCCACCTCGGCGCGCGGATCTAC
GCGACCGCCAGCACCGGGAAACAACACATCCTGCGCGAAGCCGGTCTCGAAGACACCCAC
ATCGCCGACTCCCGCACACTGAGTTTCCAGGAAACCTTCCTCAACAACACACACGGCCAG
GGCGTCGATGTCGTCCTGAACTCCCTCAGCGGTGACTTCGTCGACGCCTCCCTCGACCTG
CTGCCCCGCGGCGGCCGGTTCGTCGAGATGGGCAAGACCGACATCCGTGACCCGCACCAG
GTCACCGCCGACCGGCCGGGCACCACCTACCAGGCCTTCGACCTGATGGACGCCGGCCCG
GACCGGCTACGGGAAATCATCACCGAACTCCTCACCCTGTTCACGCAAGGCGTCCTACTG
CCCCTGCCGGTGCAGGCCTGGGACATCCGCCAGGCCCGCGATGCGTTCAGCTGGATGAGC
CGCGCCCGCCACATCGGCAAGATCGTCCTCACCATCCCCCGCCGGCCGGACCCCGACGGC
ACCATCCTGATCACCGGCGGCTCCGGCGTCCTGGCAGGCATCCTCGCCCGCCACCTGGCA
GCCGAACACGGTGCACGTCACCTCCTGCTGCTGTCCCGCACCACCCCCGACCAAGCACTG
ATCAAGGAGCTTGCCGAGCTGGGCGCCCACGTCGACACAGCCACCTGCGACGTGTCGGAC
CGTGCCGGGCTGGCGCGCGTACTGGCGGGCGTATCACCCGAACACCCCCTGACCGCCGTG
ATCCACACCGCCGGCGCACTCGACGACGGCGTCGTGGAATCCCTCACCACACAACAGCTC
GACACGGTGCTACGGCCCAAGGCCGACGGCGCCTGGCACCTACACGAACTCACCCAGAAC
ACCGACCTGGCGGCATTCGTCATGTACTCCTCCGCCGCCGGTGTCATAGGTGGCGCGGGG
CAGGGCAACTACGCGGCGGCCAACGCCTTCCTCGATGCCCTGGCCGAACAGCGCCGAGCC
GAGGGCCTGCCCGCACTCGCGCTCGCCTGGGGCCTATGGGACGACACCAGCGGCCTCACC
TCCGGGCTGACCGACACGGACCACGATCGGATCCGGCGCAGCGGCATGCGCACCATCACC
GCCGAGCACGGAATGCGGCTGTTCGACGGCGCGTCACGCCACGGTGAGCCGGTCCTGTTC
GCCGCGGCGATGTCTCCGCTACGGGGGGACGTCGAGGTCCCCGCGCTGCTGCGCGGACTT
CAAACGGTGAAGCGTCCGCAGTCCAGGACCGCGGCACGCAACGAGGTCGGCTCGCAGCCC
CTGAGCGCCCGTCTCACCGGCCGTACGAGCGTCGAGCAGCACCGCATCATGCTCGAACTC
GTGCTGGAGAGGCGCTCCGTACTCGGCCACAGCTCGGCGGATGCGATCGCGACGGACACG
TCGTTCAAGGATCTGGGCATGGATTCCCTGACGGCGATCGAACTCCGTAACCGCCTCGTG
GCGGAGACCGGGCTGCAGCTTCCCGCCACGATGGTGTTCGACTACCCGACGGCGAACGCT
CTGGCCGCGCATCTGCTGGGCAAGCTCGATATCCCGCCCGTACAGCAACGCCTCGAAGCT
CCGGCGCCGAGCACGGTCACCGGCCCGGCCGATCCGGTCGCGGATGAGCCGTCGGCGAAT
GAGCCGATCGCCATCGTGGCGATGGCGTGCCGGCTGCCAGGCGGGGTCAGTTCCCCGGAG
GGTTTGTGGCACCTTGTGGAGTCCGGCACTGACGCGATCTCCGGTTTCCCCACCGACCGT
GGCTGGGACGTCGAGGGCTTGTTCGATCCGGATCCGGACGCCGCCGGTAAGTCGTACTGC
GTGCAGGGCGGCTTCCTGGACACCGCGGCCGACTTCGACGCTCCCTTCTTCGGCATAAGC
CCGCGTGAGGCGCTGGGCATGGATCCGCAGCAGCGGCTGTTGCTGGAAACCACCTGGGAG
GCGATCGAGCGCGCGCAGATCGATCCGAAGTCCCTCCGGGGTCGCGATGTGGGCGTGTAC
GTGGGTGGCGCGGCACAGGGTTACGGAGTGGGTGTCGACCAGCAGCACGACAACGGGATC
ACCGGTAGCTCGGTCAGCCTGCTGTCGGGGCGGGTGTCATACGCGCTCGGGTTGGAGGGG
CCGGGGGTCACCGTGGACACCGCTTGCTCCTCCTCCCTGGTGGCGCTGCACCTCGCGAGC
CAGGCGTTGAGGCAGCGCGAGTGCTCGCTGGCGCTGGTGAGCGGGGTCTCGGTGATGTCC
TCGCCCGCGATGTTCGTGGAATTCTCCCGCCAGCGCGGCCTGTCGTCCGATGGCCGGTGC
AAGTCGTTCGCCGCGTCGGCGGACGGCACGATCTGGTCCGAGGGCGTGGGTGTCCTGGTG
GTGGAACGGCTTTCCGACGCCCGTCGGCTGGGGCACCGGGTCCTCGCCACCGTCCGGGGC
AGCGCGGTGAACTCCGACGGCGCGTCGAACGGGCTGACCGCACCGAACGGCACGTCCCAG
CAGCGGGTGATCCGGCAGGCGCTGGCCAACGCCGGTCTCACCGCGTCGGACGTGGATGTG
GTCGAGGCGCACGGCACCGGCACGAAGCTCGGCGACCCGATCGAGGCAGAGGCCATTCTG
GCGACGTACGGGCAAGAGCGGTCGGCGCCCGCCTGGCTCGGCTCGCTGAAGTCGAACATC
GGCCACGCCATGGCGGCGTCGGGCGTGCTCAGCGTGATCAAGATGGTGGAGGCGATGGCG
CACGGTTCGCTCCCCCGTACGCTCCATGTGGACGCGCCATCGCCTCACGTGGACTGGACA
TCGGGAAGCGTCGCGCTGCTGACGGAGCACCAGCCGTGGCCGGATGACACCAAGCTGCGC
AGGGCCGGCGTGTCGTCGTTCGGGCTCAGCGGTACCAACGCGCACGTGGTGCTGGAGCAG
TACCAGGCGCCCGCCCCGCCGGTCACGCCGGTCACGCCCGCCCCGCCGGTCACGCCGGTC
ACGCCGGTCACGCCGAATGAGCCCGGACCGCTGCCGTGGGTCTTGTCCGCGCAGAGCCCG
AAAGCGCTACGGGAGCAAGCCGGGCGGCTGTACGCCTCCCTCGCCGGGGACTCGGAGTGG
AACTCGCTGGACATCGGATACTCCCTGGCGACCACACGATCGGACTTCGCCCACCGGGCA
GTCGCGGTGGGATCCGGCCGGGAGGACTTCCTGCGCGCGCTGTCCAAGCTGGCGGACGGC
GCCCCTTGGCCCGGGCTCACGACCGCGACCGCGACCGCCAAGGCCCGGCGCGTTGCCTTC
CTGTTCGACGGGCAAGGCACCCAACGGCTGGGAATGGGCAAGGAGCTGTACGACAGCTAC
CCCGCCTTCGCACGTGCCTGGGACACGGTGAGCGCCGGGTTCGACAAGCACCTCGACCAC
TCGCTGACGGACGTCTGCTTCGGTGAGGGCGGTTCGACGACGGCCGGGCTCGTGGATGAC
ACCCTCTACGCGCAAGCGGGCATTTTCGCGATGGAGGCCGCGCTTTTCGGGCTGCTGGAG
GACTGGGGCGTGCGCCCCGACTTCGTCGCCGGGCACTCCATCGGTGAGGCAACCGCCGCG
TACGCCAGCGGGATGCTCTCGCTCGAAAACGTCACCACTCTGATCGTCGCCCGGGGTCGA
GCGCTGCGGACGACACCGCCGGGAGCCATGGTCGCGCTGCGGGCAGGTGAGGAAGAGGTG
AGGGAGTTCCTCAGCCGGACCGGTGCGGCGCTGGATCTGGCGGCGGTCAACAGCCCCGAG
GCCGTCGTCGTGTCGGGTGAGCCGGAGCCGGTGGCGGACTTCGAGGCCGCGTGGACGGCG
TCCGGGCGGGAGGCCAGGAAACTGAAGGTCCGCCATGCCTTCCACTCCCGCCATGTGGAG
GCCGTGCTGGATGAGTTCCGTACGGCACTGGAGTCCCTGAAGTTCCGTGCCCCTGCGCTG
CCCGTGGTATCGACCGTGACCGGGCGTCTGATCGACCAGGATGAGATGGGCACGCCGGAG
TATTGGTTGCGCCAGGTCCGGCGACCCGTCCGCTTCCAGGACGCCGTCCGCGAACTGGCC
GAGCAGGGTGTGGGCACATTCGTCGAGGTAGGGCCTTCGGGGGCGCTCGCGTCGGCCGGA
GTGGAGTGTCTGGGCGGCGACGCCTCGTTCCACGCCGTGCTACGCCCGCGGTCGCCGGAG
GACGTCTGTCTGATGACGGCCATCGCGGAGTTGCACGCGGGCGGGACGGCAATCGACTGG
GCGAAGGTCTTGTCCGGCGGCCGGGCGGTGGATCTGCCGGTCTATCCGTTCCAGCACCAG
TCCTACTGGCTGGCCCCGGCCGCCCCGGATGCCACAGCTGTGGCGCCCGTGGTCGAGGAG
GAGGGCGGCGAGTATGACGAGCCCTCCTATGCGGATGAGCCCCGCACCATGCTGGAACTC
GTTCACATGGAGGTGGCGAGCCTCCTGGGCATGGCCGACCCCGGCGTCATACTCGACGAC
TCGTCCTTCCTGGAGTTGGGATTCGACTCGCTCAGCGCCGTTCGGCTGCGCAACCGGCTG
TCGAAGGCCACCGGACTCGATCTACCGTCCACGCTTCTCTTCGAGCACCCCACGTCGGCG
GAATTGGCCGCGCACTTGGATGCGTTGCTTGATTCCGACATCGACGCGGCCGGCGTTTAT
GCGCTGCTGGAAGAGATCAACGAACTGGACGCAGAAGCCGTCGACATGACCGCGGCGGAA
CATAAGGCCATTTCCGAACTGCTGGAACAGCTCTCGGCAAAATGGAGGACCAGGAACGAA
TAA
[11] KS34..404
[11] AT544..782
[11] malonyl-CoA714..718
[11] dh860..1007
[11] KR1270..1446
[11] ACP1534..1608
[12] KS1630..1995
[12] AT2131..2368
[12] malonyl-CoA2301..2305
[12] dh2447..2590
[12] KR2855..3031
[12] ACP3121..3195
[13] KS3217..3585
[13] AT3725..4028
[13] methylmalonyl-CoA3909..3912
[13] DH4068..4229
[13] ER4525..4830
[13] KR4840..5016
[13] ACP5113..5186
[14] KS5220..5591
[14] AT5760..6075
[14] malonyl-CoA5952..5956
[14] ACP6137..6207
[11] KS100..1212
[11] AT1630..2346
[11] malonyl-CoA2140..2154
[11] dh2578..3021
[11] KR3808..4338
[11] ACP4600..4824
[12] KS4888..5985
[12] AT6391..7104
[12] malonyl-CoA6901..6915
[12] dh7339..7770
[12] KR8563..9093
[12] ACP9361..9585
[13] KS9649..10755
[13] AT11173..12084
[13] methylmalonyl-CoA11725..11736
[13] DH12202..12687
[13] ER13573..14490
[13] KR14518..15048
[13] ACP15337..15558
[14] KS15658..16773
[14] AT17278..18225
[14] malonyl-CoA17854..17868
[14] ACP18409..18621

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [537-653]  G3DSA:3.40.366.10 [714-795]  G3DSA:3.40.366.10 [2123-2240]  G3DSA:3.40.366.10 [2301-2381]  G3DSA:3.40.366.10 [3717-3845]  G3DSA:3.40.366.10 [3909-4018]  G3DSA:3.40.366.10 [5749-5885]  G3DSA:3.40.366.10 [5952-6066]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [2855-3018]  1.9e-58 PF00106 [4840-5003]  6.90000000000001e-58 PF00106
PF00106   adh_short
IPR002364 Quinone oxidoreductase/zeta-crystallin, conserved site (Conserved_site)
 [4652-4673]  PS01162
PS01162   QOR_ZETA_CRYSTAL
IPR006162 Phosphopantetheine attachment site (PTM)
 [1566-1581]  PS00012 [3153-3168]  PS00012 [5144-5159]  PS00012 [6165-6180]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1534-1608]  PS50075 [3121-3195]  PS50075 [5113-5186]  PS50075 [6137-6207]  PS50075
PS50075   ACP_DOMAIN
 [1531-1646]  3.0999994589937e-27 SSF47336 [3118-3233]  6.59999852526375e-27 SSF47336 [5109-5237]  2.90000354677981e-22 SSF47336 [6129-6224]  1.39999892049878e-19 SSF47336
SSF47336   ACP_like
 [1545-1607]  5.8e-11 PF00550 [3129-3192]  1.9e-10 PF00550 [5126-5185]  3.60000000000001e-12 PF00550 [6144-6206]  2.80000000000001e-13 PF00550
PF00550   PP-binding
 [1536-1610]  1.79999999999997e-78 G3DSA:1.10.1200.10 [3123-3196]  1.79999999999997e-78 G3DSA:1.10.1200.10 [5125-5189]  1.79999999999997e-78 G3DSA:1.10.1200.10 [6137-6210]  1.79999999999997e-78 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR011032 GroES-like (Domain)
 [4514-4670]  2.60000517657733e-32 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [4663-4761]  5.30000000000001e-17 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [4544-4600]  1.5e-07 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [1270-1445]  9.09999999999992e-62 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [34-280]  4.40000000000003e-92 PF00109 [1630-1871]  7.20000000000003e-88 PF00109 [3217-3461]  4.89999999999996e-86 PF00109 [5220-5467]  1.29999999999998e-91 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [288-404]  4.80000000000003e-45 PF02801 [1879-1995]  2.19999999999997e-47 PF02801 [3469-3585]  1e-45 PF02801 [5475-5591]  1.9e-45 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [544-782]  5.19999999999996e-43 PF00698 [2131-2368]  2.19999999999997e-44 PF00698 [3725-4028]  6.70000000000005e-85 PF00698 [5760-6075]  6.6999999999999e-61 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [1-25]  2.8e-07 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [542-814]  1.20000117458134e-54 SSF52151 [2129-2401]  4.30000170645869e-54 SSF52151 [3723-4017]  7.40000780398343e-58 SSF52151 [5757-6046]  2.60000517657733e-64 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [655-713]  1e-11 SSF55048 [2242-2300]  1e-11 SSF55048 [3848-3908]  1.09999909120787e-15 SSF55048 [5886-5951]  4.30000170645867e-15 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [37-292]  G3DSA:3.40.47.10 [294-457]  G3DSA:3.40.47.10 [1633-1883]  G3DSA:3.40.47.10 [1884-2048]  G3DSA:3.40.47.10 [3220-3473]  G3DSA:3.40.47.10 [3475-3638]  G3DSA:3.40.47.10 [5223-5479]  G3DSA:3.40.47.10 [5480-5642]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [26-402]  1.59998835313644e-97 SSF53901 [1622-1993]  1.39999277195148e-99 SSF53901 [3209-3583]  9.69997533354407e-94 SSF53901 [5213-5643]  4.60000044330866e-101 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1270-1452]  5.99999999999995e-108 G3DSA:3.40.50.720 [2855-3038]  5.99999999999995e-108 G3DSA:3.40.50.720 [4660-4756]  5.20000000000001e-20 G3DSA:3.40.50.720 [4840-5023]  5.99999999999995e-108 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [193-209]  PS00606 [1784-1800]  PS00606 [3374-3390]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [546-812]  4.80002938964646e-94 SM00827 [2133-2399]  3.89999861795218e-94 SM00827 [3727-4009]  2.39999798157263e-100 SM00827 [5761-6058]  5.60004908290974e-106 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1539-1611]  2.30000440726534e-29 SM00823 [3126-3198]  1.29999924468179e-26 SM00823 [5118-5189]  1.39999892049878e-30 SM00823 [6138-6210]  1e-29 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [860-1007]  8.69997440322062e-46 SM00826 [2447-2590]  2.50000909916183e-47 SM00826 [4068-4229]  4.40002866058555e-80 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [36-456]  SM00825 [1632-2047]  SM00825 [3219-3637]  SM00825 [5223-5643]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1270-1446]  4.30000170645869e-58 SM00822 [2855-3031]  9.60004130884281e-58 SM00822 [4840-5016]  1.3000049540733e-57 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [4525-4830]  SM00829
SM00829   PKS_ER
SignalP
 [1-31]  0.077 Signal
Eukaryota   
TMHMM No significant hit