close all open/close all

CDS information : Rapam_00150


close this sectionLocation

Organism
StrainNRRL 5491
Entry nameRapamycin
Contig
Start / Stop / Direction90,798 / 91,433 / + [in whole cluster]
90,798 / 91,433 / + [in contig]
Location90798..91433 [in whole cluster]
90798..91433 [in contig]
TypeCDS
Length636 bp (211 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
ProductC-27 O-methyltransferase
Product (GenBank)methyltransferase
Gene
Gene (GenBank)rapQ
EC number2.1.1.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[7644502] The biosynthetic gene cluster for the polyketide immunosuppressant rapamycin. (Proc Natl Acad Sci U S A. , 1995)
[8635730] Organisation of the biosynthetic gene cluster for rapamycin in Streptomyces hygroscopicus: analysis of genes flanking the polyketide synthase. (Gene. , 1996)
[11372782] Deletion of rapQONML from the rapamycin gene cluster of Streptomyces hygroscopicus gives production of the 16-O-desmethyl-27-desmethoxy analog. (J Antibiot (Tokyo). , 2001)
[16990929] Rapamycin biosynthesis: Elucidation of gene product function. (Org Biomol Chem. , 2006)

close this sectionSequence

selected fasta
>C-27 O-methyltransferase [methyltransferase]
MMLELGTRLKFRFTGPLLEAVNPRLQGHPYDVLMRLLEGGRIENVLELCGGTGFASRMLA
ERHSKVQATSIDLSPELTAVGPHKLASRGIDNVTLVEGDVSTLPYPDDSFDTVMSAFGLH
EVPTAGRLSAIRESVRVLKPGGRFVIVDLDRRTKYGWTMDLFMKVMEPKFAPEVFGTGLV
DRLKENGFTIDHHESAGPNGWTQSIVATLEA
selected fasta
>C-27 O-methyltransferase [methyltransferase]
GTGATGTTGGAATTGGGTACCCGCCTGAAGTTCAGATTTACCGGACCGCTCCTCGAAGCT
GTCAATCCGCGCCTGCAGGGTCACCCCTACGACGTACTGATGCGCCTCCTCGAGGGCGGT
CGCATCGAAAACGTGCTGGAATTGTGCGGCGGGACCGGATTCGCGTCGCGAATGCTGGCC
GAAAGGCATTCGAAGGTACAGGCCACCTCCATCGATCTGTCACCCGAACTGACCGCGGTA
GGCCCCCACAAGTTGGCCTCGCGGGGGATCGATAACGTCACCCTGGTCGAGGGTGACGTT
TCCACCTTGCCTTACCCCGACGACTCGTTCGACACCGTGATGTCGGCCTTCGGTCTGCAC
GAGGTCCCGACCGCGGGCCGCCTCAGCGCGATCCGCGAGTCCGTGCGGGTGCTCAAGCCC
GGCGGCCGCTTCGTCATCGTCGATCTCGACCGCCGGACAAAGTACGGGTGGACGATGGAC
CTCTTCATGAAGGTCATGGAGCCGAAGTTCGCCCCCGAGGTGTTCGGAACCGGCCTGGTG
GACCGGCTGAAAGAGAACGGTTTCACCATCGACCATCACGAGTCGGCCGGGCCGAACGGA
TGGACACAGTCGATCGTCGCCACCCTGGAGGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004033 UbiE/COQ5 methyltransferase (Family)
 [35-156]  1e-18 PF01209
PF01209   Ubie_methyltran
SignalP No significant hit
TMHMM No significant hit