close all open/close all

CDS information : Rapam_00160


close this sectionLocation

Organism
StrainNRRL 5491
Entry nameRapamycin
Contig
Start / Stop / Direction91,767 / 91,534 / - [in whole cluster]
91,767 / 91,534 / - [in contig]
Locationcomplement(91534..91767) [in whole cluster]
complement(91534..91767) [in contig]
TypeCDS
Length234 bp (77 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.5 electron carrier
Productputative ferredoxin
Product (GenBank)ferredoxin
Gene
Gene (GenBank)rapO
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[7644502] The biosynthetic gene cluster for the polyketide immunosuppressant rapamycin. (Proc Natl Acad Sci U S A. , 1995)
[8635730] Organisation of the biosynthetic gene cluster for rapamycin in Streptomyces hygroscopicus: analysis of genes flanking the polyketide synthase. (Gene. , 1996)
Related Reference
ACC
P29603
PmId
[8045914] Cloning, expression, and molecular characterization of the gene encoding an extremely thermostable [4Fe-4S] ferredoxin from the hyperthermophilic archaeon Pyrococcus furiosus. (J Bacteriol. , 1994)

close this sectionSequence

selected fasta
>putative ferredoxin [ferredoxin]
MSGMARWELWIDRTECIGSAVCVASAGAYFEMHGHQSRARASEIDADEHVIAVAQACPSG
AIHVRVKETGELLEPQD
selected fasta
>putative ferredoxin [ferredoxin]
GTGAGTGGCATGGCGCGATGGGAGCTGTGGATCGACCGGACCGAGTGCATCGGCTCGGCC
GTCTGCGTGGCCAGCGCGGGCGCGTACTTCGAGATGCACGGGCACCAGTCGCGCGCCCGC
GCGAGCGAGATCGACGCGGACGAGCACGTGATCGCGGTGGCGCAGGCCTGCCCGTCGGGG
GCGATCCACGTCCGGGTCAAGGAGACCGGCGAGCTTCTCGAACCCCAGGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-41]  0.191 Signal
Bacteria, Gram-negative   
TMHMM No significant hit