close all open/close all

CDS information : Rapam_00170


close this sectionLocation

Organism
StrainNRRL 5491
Entry nameRapamycin
Contig
Start / Stop / Direction92,978 / 91,764 / - [in whole cluster]
92,978 / 91,764 / - [in contig]
Locationcomplement(91764..92978) [in whole cluster]
complement(91764..92978) [in contig]
TypeCDS
Length1,215 bp (404 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productcytochrome P450
Product (GenBank)cytochrome P450
Gene
Gene (GenBank)rapN
EC number
Keyword
  • C-27 hydroxylate
Note
Note (GenBank)
Reference
ACC
PmId
[7644502] The biosynthetic gene cluster for the polyketide immunosuppressant rapamycin. (Proc Natl Acad Sci U S A. , 1995)
[8635730] Organisation of the biosynthetic gene cluster for rapamycin in Streptomyces hygroscopicus: analysis of genes flanking the polyketide synthase. (Gene. , 1996)
[11372782] Deletion of rapQONML from the rapamycin gene cluster of Streptomyces hygroscopicus gives production of the 16-O-desmethyl-27-desmethoxy analog. (J Antibiot (Tokyo). , 2001)
[16990929] Rapamycin biosynthesis: Elucidation of gene product function. (Org Biomol Chem. , 2006)

close this sectionSequence

selected fasta
>cytochrome P450 [cytochrome P450]
MSTTDQGETGKACPYPFAEMERLEIHPEYNRLRDAGELGRVLMLDGREAWLAASWEDVAK
VFVDPRFSRSATLGKDVPRVLPAIQDQPVIMLMDPPEHTRLRRVATKALTSRRMEALRPR
TQEVADDLIDKMLAKGAPADLMEDFALPLPIIMICELLGVPIEDQTKFRTWSDQMLSNGA
YSQEVVMAAGQSLYLYLSELIAERRKQDTNDLLGSLVRARDKDDRLSETELVGFAVTLLI
AGYETTANAIGNSVYTLLTHPEKLAELRKDLSLIPKAVDELLRIIPIAKQASWVRMAVED
VELSGTIVKAGEAVAIQTHSANTDPKVYDHPEEIDFHRTSNPHMSLGHGAHHCMGAQLVR
VEMQTALGSLISRIPALRFAVPEPRIKFLRGRLVPSLEALPLTW
selected fasta
>cytochrome P450 [cytochrome P450]
ATGTCGACGACCGATCAGGGTGAGACCGGAAAGGCCTGCCCTTATCCTTTCGCCGAAATG
GAGCGACTCGAGATCCACCCCGAGTACAACCGGCTGCGGGACGCCGGTGAGCTCGGCCGG
GTCCTGATGTTGGACGGCCGGGAGGCCTGGCTGGCCGCCAGCTGGGAGGACGTCGCCAAG
GTGTTCGTGGACCCGCGGTTCAGCCGCAGCGCGACGCTCGGCAAGGACGTGCCCCGGGTC
CTCCCGGCGATCCAGGACCAGCCCGTCATCATGCTGATGGACCCTCCGGAACACACCCGG
CTGCGCCGGGTGGCGACCAAGGCGCTGACCAGCCGCCGGATGGAGGCCCTGCGTCCGCGC
ACCCAGGAGGTCGCCGACGATCTGATCGACAAAATGCTGGCCAAGGGCGCCCCCGCCGAT
CTGATGGAGGACTTCGCCCTGCCTCTGCCGATCATCATGATCTGTGAGCTGCTGGGCGTG
CCGATCGAGGACCAGACCAAGTTCCGGACCTGGTCGGACCAGATGCTCTCGAACGGCGCC
TACTCACAGGAAGTCGTGATGGCGGCCGGCCAGTCGCTCTACCTCTACCTCTCCGAGCTG
ATCGCGGAACGTCGCAAGCAGGACACCAACGATCTGCTCGGGTCGCTGGTGCGGGCCCGC
GACAAGGACGACCGGCTCAGCGAGACGGAGCTGGTCGGCTTCGCCGTCACACTGCTGATA
GCGGGATACGAGACCACCGCCAACGCGATCGGCAACAGCGTCTACACCCTGCTGACCCAC
CCGGAGAAACTCGCCGAACTGCGAAAGGACCTCTCGCTGATCCCGAAGGCGGTCGACGAG
TTGCTCCGGATCATCCCGATCGCCAAGCAGGCGAGCTGGGTCCGGATGGCGGTGGAGGAC
GTCGAGCTCAGCGGCACGATCGTCAAGGCCGGTGAGGCGGTGGCGATCCAGACGCACTCG
GCCAACACCGACCCCAAGGTCTACGACCATCCGGAGGAGATCGACTTCCACCGGACGAGC
AACCCGCACATGTCCCTCGGACACGGCGCGCACCACTGCATGGGCGCTCAACTCGTCCGG
GTGGAGATGCAGACCGCGCTCGGCTCGCTCATCTCCCGTATCCCGGCGCTGCGGTTCGCG
GTGCCGGAGCCGCGGATCAAGTTCCTGCGCGGGCGGCTGGTGCCCAGCCTCGAAGCGTTG
CCCCTGACATGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [241-258]  2.4000006166714e-06 PR00385 [276-287]  2.4000006166714e-06 PR00385 [344-353]  2.4000006166714e-06 PR00385 [353-364]  2.4000006166714e-06 PR00385
PR00385   P450
 [23-404]  5.20000089003336e-96 SSF48264
SSF48264   Cytochrome_P450
 [20-404]  4.49999999999996e-109 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [202-373]  3.7e-23 PF00067
PF00067   p450
IPR002397 Cytochrome P450, B-class (Family)
 [93-104]  1.3000049540733e-56 PR00359 [140-156]  1.3000049540733e-56 PR00359 [157-172]  1.3000049540733e-56 PR00359 [195-217]  1.3000049540733e-56 PR00359 [276-287]  1.3000049540733e-56 PR00359 [295-322]  1.3000049540733e-56 PR00359 [323-338]  1.3000049540733e-56 PR00359 [344-353]  1.3000049540733e-56 PR00359 [353-364]  1.3000049540733e-56 PR00359
PR00359   BP450
SignalP No significant hit
TMHMM No significant hit