close all open/close all

CDS information : Rapam_00190


close this sectionLocation

Organism
StrainNRRL 5491
Entry nameRapamycin
Contig
Start / Stop / Direction95,078 / 94,047 / - [in whole cluster]
95,078 / 94,047 / - [in contig]
Locationcomplement(94047..95078) [in whole cluster]
complement(94047..95078) [in contig]
TypeCDS
Length1,032 bp (343 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productlysine cyclodeaminase
Product (GenBank)lysine cyclodeaminase
Gene
Gene (GenBank)rapL
EC number
Keyword
  • L-pipecolate
Note
Note (GenBank)
Reference
ACC
PmId
[7644502] The biosynthetic gene cluster for the polyketide immunosuppressant rapamycin. (Proc Natl Acad Sci U S A. , 1995)
[8635730] Organisation of the biosynthetic gene cluster for rapamycin in Streptomyces hygroscopicus: analysis of genes flanking the polyketide synthase. (Gene. , 1996)
[9473033] Mutational biosynthesis of novel rapamycins by a strain of Streptomyces hygroscopicus NRRL 5491 disrupted in rapL, encoding a putative lysine cyclodeaminase. (J Bacteriol. , 1998)
[16536560] Biosynthesis of pipecolic acid by RapL, a lysine cyclodeaminase encoded in the rapamycin gene cluster. (J Am Chem Soc. , 2006)

close this sectionSequence

selected fasta
>lysine cyclodeaminase [lysine cyclodeaminase]
MQTKVLCQRDIKRILSVVGRDVMMDRLISEVHAGFARLGRGETDEPPPRPGFARGGDVPG
VIEFMPHRASGIGVTMKTVSYSPENFERFNLPTIVGTVSRLGDDSGSMVALADAATITAM
RTGAVASVTTRLLARPGSTTLALIGAGAQAVTQAHALSRVLPLERILISDIKAEHAESFA
GRVAFLELPVEVTDAATAMATADVLCTVTSVPVGGGPVVPAEPRQAHLHVNGIGADEQGK
TELPKALLDDAFICVDHPGQARAEGEFQQLPDRELGPSLADLCAAPEIAAPHPERLSVFD
STGSAFADHIALDVLLGFADELGLGHKMSIESTPEDVLDPYSL
selected fasta
>lysine cyclodeaminase [lysine cyclodeaminase]
ATGCAGACCAAGGTTCTGTGCCAGCGTGACATCAAGCGGATCCTCTCGGTGGTCGGCCGC
GACGTCATGATGGATCGGCTGATCAGCGAGGTGCACGCCGGTTTCGCGCGATTGGGCCGC
GGCGAGACCGACGAGCCGCCACCGCGTCCCGGCTTTGCCCGCGGCGGCGACGTTCCGGGC
GTCATCGAGTTCATGCCGCACCGCGCGTCGGGCATCGGTGTGACGATGAAGACGGTCAGC
TACAGTCCGGAGAACTTCGAGCGCTTCAACCTGCCCACCATCGTGGGGACCGTGTCGCGG
CTCGGCGACGACAGCGGAAGCATGGTCGCGCTCGCCGACGCGGCCACCATCACCGCGATG
CGGACCGGCGCGGTCGCGTCCGTCACCACCCGGCTGCTCGCCCGGCCGGGGAGCACCACC
CTCGCCCTGATCGGCGCGGGCGCCCAGGCGGTCACCCAGGCACACGCCCTCAGCCGCGTC
CTCCCACTGGAACGCATCCTGATCAGTGACATCAAAGCTGAGCACGCGGAGTCGTTCGCC
GGCCGGGTCGCGTTTCTCGAGCTGCCCGTCGAGGTCACCGACGCGGCGACCGCGATGGCG
ACCGCGGACGTCCTGTGCACCGTCACATCGGTACCGGTCGGCGGCGGGCCGGTGGTGCCG
GCCGAACCGCGCCAGGCACATCTGCACGTCAATGGCATCGGCGCGGACGAGCAGGGCAAG
ACCGAGCTGCCCAAGGCGCTGCTCGACGACGCGTTCATCTGCGTCGACCACCCCGGGCAG
GCCCGCGCCGAGGGCGAGTTCCAGCAGCTGCCCGATCGGGAACTCGGCCCGTCGCTGGCC
GACCTGTGCGCGGCACCCGAGATCGCCGCTCCGCACCCGGAGCGCCTGAGCGTCTTCGAC
TCGACCGGCAGCGCGTTCGCCGACCACATCGCCCTCGACGTACTGCTCGGCTTCGCCGAC
GAACTCGGCCTCGGCCACAAGATGTCGATCGAGTCGACGCCCGAGGACGTCCTCGATCCG
TACTCGCTGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003462 Ornithine cyclodeaminase/mu-crystallin (Family)
 [1-331]  5.99999044089058e-28 PIRSF001439
PIRSF001439   CryM
 [10-322]  3.60000000000002e-107 PF02423
PF02423   OCD_Mu_crystall
IPR016040 NAD(P)-binding domain (Domain)
 [135-303]  2.59999999999998e-40 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit