close all open/close all

CDS information : Rapam_00200


close this sectionLocation

Organism
StrainNRRL 5491
Entry nameRapamycin
Contig
Start / Stop / Direction95,430 / 96,434 / + [in whole cluster]
95,430 / 96,434 / + [in contig]
Location95430..96434 [in whole cluster]
95430..96434 [in contig]
TypeCDS
Length1,005 bp (334 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative chorismatase
putative chorismate hydrolase
Product (GenBank)pteridine-dependent dioxygenase
Gene
Gene (GenBank)rapK
EC number
Keyword
  • 4,5-dihydroxycyclohex-1-ene carboxylic acid
Note
Note (GenBank)
Reference
ACC
PmId
[7644502] The biosynthetic gene cluster for the polyketide immunosuppressant rapamycin. (Proc Natl Acad Sci U S A. , 1995)
[8635730] Organisation of the biosynthetic gene cluster for rapamycin in Streptomyces hygroscopicus: analysis of genes flanking the polyketide synthase. (Gene. , 1996)
[15127450] Isolation and characterization of pre-rapamycin, the first macrocyclic intermediate in the biosynthesis of the immunosuppressant rapamycin by S. hygroscopicus. (Angew Chem Int Ed Engl. , 2004)
[21383123] Biosynthesis of the immunosuppressants FK506, FK520, and rapamycin involves a previously undescribed family of enzymes acting on chorismate. (Proc Natl Acad Sci U S A. , 2011)
Related Reference
ACC
Q9KID9
NITE
Asco_00150
PmId
[21383123] Biosynthesis of the immunosuppressants FK506, FK520, and rapamycin involves a previously undescribed family of enzymes acting on chorismate. (Proc Natl Acad Sci U S A. , 2011)
[24036425] Mechanistic implications for the chorismatase FkbO based on the crystal structure. (J Mol Biol. , 2014)
[26247872] Chorismatase Mechanisms Reveal Fundamentally Different Types of Reaction in a Single Conserved Protein Fold. (J Am Chem Soc. , 2015)

close this sectionSequence

selected fasta
>putative chorismatase [pteridine-dependent dioxygenase]
MRQLTPPVTAPYCRFEKLGASDLDGDETLLGVIEHRTGHTGVSLAEGCPRTAVHTTTRED
ESFAEAWHAEGPKESSRHDGVAWARTPDYLFGVARVPEGGRYAAGTAAVYTGIFDLIGTL
GYPSLARTWNYVSGINTPNADGLEVYRDFCVGRAEALDARGIDPATMPAATGIGAHGARI
TCYFIAARAGDRVNMENPAVLTAHRYPQRYGPRPPVFSGHLALAAGGGRLFVSATAGIVG
QETVHHGDVAAQCEVSLENIARVIGAENLGRHGLRRGYALADVDHLKVYVRHREDISTVR
RICAERLSREATVAVLHTDIARTDLLVEIEGVVA
selected fasta
>putative chorismatase [pteridine-dependent dioxygenase]
GTGAGGCAATTGACTCCGCCGGTCACGGCACCGTACTGCCGCTTCGAGAAGCTCGGCGCC
TCCGATCTCGACGGCGACGAGACACTTCTCGGCGTCATCGAACATCGCACCGGACACACC
GGGGTTTCACTGGCCGAGGGCTGTCCCCGGACGGCCGTACACACGACGACCCGCGAGGAC
GAGTCGTTCGCCGAGGCGTGGCACGCGGAGGGGCCGAAGGAGTCGTCGAGGCATGATGGC
GTCGCCTGGGCTCGGACACCTGACTACCTCTTCGGTGTCGCGCGGGTGCCCGAGGGCGGC
CGGTACGCGGCCGGCACCGCGGCCGTCTACACCGGAATCTTCGACCTGATCGGGACGCTG
GGGTACCCCAGTCTGGCCCGCACCTGGAACTACGTCAGCGGAATCAACACGCCGAACGCC
GATGGCCTCGAGGTCTACCGGGACTTCTGTGTGGGCCGCGCCGAGGCGCTGGACGCCCGT
GGGATCGACCCGGCGACCATGCCGGCGGCGACCGGCATCGGCGCCCACGGCGCGCGCATC
ACGTGCTACTTCATCGCCGCACGCGCCGGTGACCGGGTCAACATGGAGAACCCGGCCGTG
CTCACGGCTCACCGCTACCCGCAGCGGTACGGCCCCCGCCCGCCGGTCTTCTCCGGCCAC
CTGGCTCTCGCCGCCGGGGGCGGACGGCTCTTCGTCTCCGCGACCGCCGGCATCGTCGGT
CAGGAGACGGTGCACCACGGCGACGTCGCCGCGCAATGCGAGGTGTCGCTCGAGAACATC
GCCCGGGTGATCGGTGCCGAGAACCTGGGACGGCACGGGCTCCGCCGGGGCTACGCCCTC
GCCGACGTCGACCATTTGAAGGTCTATGTACGCCACCGCGAGGATATTTCGACCGTACGT
CGGATCTGCGCCGAGCGCCTCTCCCGCGAGGCCACGGTTGCCGTACTGCACACCGACATC
GCGCGCACCGATCTGCTGGTCGAGATCGAGGGTGTGGTGGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013813 Endoribonuclease L-PSP/chorismate mutase-like (Domain)
 [224-333]  1.4e-11 G3DSA:3.30.1330.40
G3DSA:3.30.1330.40   Endoribo_LPSP/chorism_mut-like
 [204-334]  2.49999811956465e-13 SSF55298
SSF55298   YjgF/chorismate_mutase-like
SignalP No significant hit
TMHMM No significant hit