close all open/close all

CDS information : Rapam_00210


close this sectionLocation

Organism
StrainNRRL 5491
Entry nameRapamycin
Contig
Start / Stop / Direction96,465 / 97,625 / + [in whole cluster]
96,465 / 97,625 / + [in contig]
Location96465..97625 [in whole cluster]
96465..97625 [in contig]
TypeCDS
Length1,161 bp (386 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productcytochrome P450
Product (GenBank)cytochrome P450
Gene
Gene (GenBank)rapJ
EC number
Keyword
  • C-9 keto group formation
Note
Note (GenBank)
Reference
ACC
PmId
[7644502] The biosynthetic gene cluster for the polyketide immunosuppressant rapamycin. (Proc Natl Acad Sci U S A. , 1995)
[8635730] Organisation of the biosynthetic gene cluster for rapamycin in Streptomyces hygroscopicus: analysis of genes flanking the polyketide synthase. (Gene. , 1996)
[11372782] Deletion of rapQONML from the rapamycin gene cluster of Streptomyces hygroscopicus gives production of the 16-O-desmethyl-27-desmethoxy analog. (J Antibiot (Tokyo). , 2001)
[16990929] Rapamycin biosynthesis: Elucidation of gene product function. (Org Biomol Chem. , 2006)
Related Reference
ACC
P77977
PmId
[8752344] Characterization of methyltransferase and hydroxylase genes involved in the biosynthesis of the immunosuppressants FK506 and FK520. (J Bacteriol. , 1996)

close this sectionSequence

selected fasta
>cytochrome P450 [cytochrome P450]
MSTEAQQESTPTARCPFSIQDGHRTILETGTVGAHELFGVKQWLVAAAEDVKLVTNDPRF
SSAAPSGILGDRRPGWFSGMDSPEHNRYRQKIARDFTLRAARKQEEFIVRAADSCLDDIE
ASGPGTDLVPGYAKRLASLAIHDLYGLNEEGPVLEGQMRAMEGGTDMESIKRLTDEFGHV
LALVRAKRDEAGDRLLHRLAESGEDEILLSDEEATGVFATLLFAGHDSMQQMVGYSLYAL
LSHPEQRAALRENPDLIDGAVEELLRFLPLNQLGVPRVCVEDVELHGQTISAGDNVIPLY
STANRDPGVFADPDTFDITRKPEHNFAFGYGIHGCPGQHLARVLIKVATVRLFERFPDVR
LAGDVPMNEGLGLFSPAELRVTWGAE
selected fasta
>cytochrome P450 [cytochrome P450]
ATGAGCACCGAAGCTCAGCAAGAGAGCACGCCCACCGCACGCTGCCCCTTCTCGATCCAG
GACGGGCACCGCACGATCCTGGAGACCGGCACGGTCGGCGCGCACGAACTCTTCGGCGTC
AAGCAATGGCTGGTGGCCGCGGCCGAGGACGTCAAGCTGGTCACCAACGACCCCCGGTTC
AGCTCGGCGGCGCCGTCCGGGATACTCGGCGACCGGCGGCCGGGCTGGTTCTCCGGGATG
GACTCGCCGGAGCACAACCGCTATCGGCAGAAGATCGCCCGGGACTTCACCCTGCGGGCC
GCGCGCAAGCAGGAGGAGTTCATCGTCCGGGCGGCGGACTCCTGCCTCGACGACATCGAG
GCGTCCGGTCCCGGCACCGATCTGGTTCCCGGGTACGCCAAGCGCCTGGCGTCCCTGGCC
ATCCACGACCTCTACGGCCTGAATGAGGAGGGGCCCGTACTCGAGGGCCAGATGCGGGCC
ATGGAGGGCGGCACCGACATGGAGAGCATCAAGAGGCTGACCGACGAATTCGGTCACGTC
CTGGCGCTGGTGCGTGCCAAGCGGGACGAGGCGGGCGACAGGCTTCTGCACCGGCTGGCC
GAGTCCGGCGAGGACGAGATCCTGCTCAGCGACGAGGAGGCGACCGGGGTGTTCGCCACT
CTGCTGTTCGCCGGGCACGACTCGATGCAGCAGATGGTCGGCTACAGTCTGTACGCGCTG
CTCTCCCATCCCGAGCAGCGGGCGGCGCTGCGGGAGAACCCGGACCTGATCGACGGCGCG
GTCGAGGAGCTGCTGCGCTTCCTGCCGCTCAACCAGCTCGGCGTGCCGCGGGTCTGTGTC
GAGGACGTCGAGCTGCACGGCCAGACCATCAGCGCCGGCGACAACGTGATCCCGCTCTAC
TCGACGGCCAACCGCGACCCCGGCGTCTTCGCCGACCCCGACACGTTCGACATCACGCGT
AAGCCCGAACACAACTTCGCTTTCGGGTACGGCATCCACGGCTGCCCGGGGCAGCACCTC
GCCCGCGTGTTGATCAAGGTCGCCACCGTGCGCCTGTTCGAGCGCTTCCCGGATGTGCGA
CTGGCGGGCGACGTGCCGATGAACGAGGGTCTGGGCCTGTTCAGCCCGGCCGAGCTCCGG
GTCACCTGGGGAGCGGAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [224-241]  7.89999609889417e-05 PR00385 [259-270]  7.89999609889417e-05 PR00385 [326-335]  7.89999609889417e-05 PR00385 [335-346]  7.89999609889417e-05 PR00385
PR00385   P450
 [28-383]  2.30000000000004e-84 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [194-356]  4.9e-26 PF00067
PF00067   p450
 [16-383]  9.40003071030835e-78 SSF48264
SSF48264   Cytochrome_P450
IPR002397 Cytochrome P450, B-class (Family)
 [80-91]  2.60000517657733e-36 PR00359 [127-143]  2.60000517657733e-36 PR00359 [178-200]  2.60000517657733e-36 PR00359 [259-270]  2.60000517657733e-36 PR00359 [277-304]  2.60000517657733e-36 PR00359 [305-320]  2.60000517657733e-36 PR00359 [326-335]  2.60000517657733e-36 PR00359 [335-346]  2.60000517657733e-36 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [328-337]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit