close all open/close all

CDS information : Rapam_00220


close this sectionLocation

Organism
StrainNRRL 5491
Entry nameRapamycin
Contig
Start / Stop / Direction97,622 / 98,404 / + [in whole cluster]
97,622 / 98,404 / + [in contig]
Location97622..98404 [in whole cluster]
97622..98404 [in contig]
TypeCDS
Length783 bp (260 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
ProductC-39 O-methyltransferase
Product (GenBank)methyltransferase
Gene
Gene (GenBank)rapI
EC number2.1.1.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[7644502] The biosynthetic gene cluster for the polyketide immunosuppressant rapamycin. (Proc Natl Acad Sci U S A. , 1995)
[8635730] Organisation of the biosynthetic gene cluster for rapamycin in Streptomyces hygroscopicus: analysis of genes flanking the polyketide synthase. (Gene. , 1996)
[11372782] Deletion of rapQONML from the rapamycin gene cluster of Streptomyces hygroscopicus gives production of the 16-O-desmethyl-27-desmethoxy analog. (J Antibiot (Tokyo). , 2001)
[16990929] Rapamycin biosynthesis: Elucidation of gene product function. (Org Biomol Chem. , 2006)
Related Reference
ACC
Q9KID5
NITE
Asco_00190
PmId
[8752344] Characterization of methyltransferase and hydroxylase genes involved in the biosynthesis of the immunosuppressants FK506 and FK520. (J Bacteriol. , 1996)

close this sectionSequence

selected fasta
>C-39 O-methyltransferase [methyltransferase]
MSASVQTIKLPYGRPSAHVNPGEAQFLYQEIFAERCYLRRGLELRAGDVVFDVGANIGMF
SLFAHLECPDVTVHAFEPAPVPYAALRANAERYAIAGRFEQCAVSDVAGRGKMTFYTDTT
MMSGFHPDPATRAELLRRLAINGGYSAEAADRMLAELPDTSQVIETSVVRLSDVIAERGI
TSIGLLKIDVEKNERHVMAGIDAGDWPRIRQVVTEVHDIDGRLDEVLTLLRGQGFTVLSE
QEPLFAGTDIYQVVARRGDA
selected fasta
>C-39 O-methyltransferase [methyltransferase]
GTGAGCGCGTCCGTGCAGACCATCAAGCTGCCGTACGGCAGACCGTCGGCCCACGTCAAC
CCGGGCGAGGCGCAGTTCCTCTACCAGGAGATCTTCGCCGAGCGGTGCTACTTGCGGCGC
GGCCTTGAGCTGCGAGCGGGTGACGTGGTCTTCGACGTCGGCGCGAACATCGGCATGTTC
TCGCTCTTCGCCCACCTGGAGTGCCCCGATGTCACGGTGCACGCCTTCGAGCCGGCGCCG
GTGCCGTACGCCGCGCTCAGGGCCAATGCCGAGCGGTACGCCATCGCGGGCCGGTTCGAG
CAGTGCGCGGTCTCGGACGTGGCCGGCCGCGGCAAGATGACGTTCTACACGGATACCACG
ATGATGTCGGGCTTCCACCCGGATCCGGCGACCCGCGCGGAGCTGCTGCGCAGGCTCGCC
ATCAACGGCGGGTACAGTGCCGAGGCCGCCGACCGGATGCTGGCCGAGCTGCCGGACACC
AGCCAGGTGATCGAGACGTCCGTCGTACGCCTCTCCGACGTCATCGCGGAGCGGGGCATC
ACCTCGATCGGACTGCTCAAGATCGATGTGGAGAAGAACGAGCGGCATGTGATGGCCGGG
ATCGACGCGGGCGACTGGCCGCGCATCCGCCAGGTCGTCACCGAGGTGCACGACATCGAC
GGCAGGCTCGACGAGGTCCTCACACTGCTGCGCGGGCAGGGCTTCACGGTCCTCAGCGAG
CAGGAGCCGCTCTTCGCCGGCACCGACATCTACCAGGTCGTCGCCCGCCGCGGGGACGCC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006342 Methyltransferase FkbM (Domain)
 [49-217]  1.4e-27 TIGR01444
TIGR01444   FkbM_fam
 [52-236]  8.20000000000006e-20 PF05050
PF05050   Methyltransf_21
SignalP No significant hit
TMHMM No significant hit