close all open/close all

CDS information : Rapam_00230


close this sectionLocation

Organism
StrainNRRL 5491
Entry nameRapamycin
Contig
Start / Stop / Direction101,085 / 98,467 / - [in whole cluster]
101,085 / 98,467 / - [in contig]
Locationcomplement(98467..101085) [in whole cluster]
complement(98467..101085) [in contig]
TypeCDS
Length2,619 bp (872 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
ProductLuxR family transcriptional activator
Product (GenBank)regulator of cholesterol oxidase
GeneorfH
rapH
Gene (GenBank)orfH
EC number
Keyword
Note
Note (GenBank)
  • putative
Reference
ACC
PmId
[7644502] The biosynthetic gene cluster for the polyketide immunosuppressant rapamycin. (Proc Natl Acad Sci U S A. , 1995)
[8635730] Organisation of the biosynthetic gene cluster for rapamycin in Streptomyces hygroscopicus: analysis of genes flanking the polyketide synthase. (Gene. , 1996)
[17468238] Roles of rapH and rapG in positive regulation of rapamycin biosynthesis in Streptomyces hygroscopicus. (J Bacteriol. , 2007)
[26608164] Interspecies Complementation of the LuxR Family Pathway-Specific Regulator Involved in Macrolide Biosynthesis. (J Microbiol Biotechnol. , 2016)

close this sectionSequence

selected fasta
>LuxR family transcriptional activator [regulator of cholesterol oxidase]
MTGRANGRGVVVTITGPIACGKTELLDAAAAKADAITLRAVCSAEEQALPYALIGQLIDN
PALASHALEPACPTLPGEHLSPEAENRLRSDLTRTLLALAAERPVLIGIDESHANALCLL
HLARRVGSARIAMVLTELRRLTPAHSQFQAELLSLGHHREIALRPLSPKHTAELVRAGLG
PDVDEDVLTGLYRATGGNLNLTRGLINDVREAWETGGTGISAGRAYRLAYLGSLYRCGPV
PLRVARVAAVLGQSANTTLVRWISGLNADAVGEATEILTEGGLLHDLRFPHPAARSVVLN
DMSAQERRRLHRSALEVLDDVPVEVVAHHQVGAGLLHGPKAAEIFAKAGQELHVRGELDT
ASDYLQLAHQASDDAVTGMRAEAVAIERRRNPLASSRHLDELTVVARAGLLFPEHTALMI
RWLGVGGRSGEAAGLLASQRPRAVTDQDRAHMRAAEVSLALVSPGTSGPDRRPRPLTPDE
LANLPKAARLCAIADNAVMSALRGRPELAAAEAENVLQHADSAAAGTTALAALTALLYAE
NTDTAQLWADKLVSETGASNEEEAGYAGPRAEAALRRGDLAAAVEAGSTVLDHRRLSTLG
ITAALPLSSAVAAAIRLGETERAEKWLAQPLPQAIQDGLFGLHLLSARGQYSLATGQHES
AYTAFRTCGERMRNWGVDVPGLSLWRVDAAEALLHGRDRDEGRRLVDEQLTRAMGPRSRA
LTLRVQAAYSPPAKRVDLLDEAADLLLSCNDQYERARVLADLSETFSALRHHSRARGLLR
QARHLAAQRGAIPLLRRLGAKPGGPGWLEESGLPQRIKSLTDAERRVASLAAGGQTNRVI
ADQLFVTASTVEQHLTDVSTGSRPPAPAAELV
selected fasta
>LuxR family transcriptional activator [regulator of cholesterol oxidase]
GTGACCGGGCGGGCCAACGGCCGGGGTGTGGTGGTCACCATCACCGGACCGATCGCCTGC
GGCAAGACCGAACTGCTCGACGCAGCCGCCGCGAAGGCCGACGCCATCACGTTACGAGCG
GTCTGCTCCGCGGAGGAACAGGCACTCCCGTACGCCCTGATCGGGCAGCTCATCGACAAC
CCGGCGCTCGCCTCCCACGCGCTGGAGCCGGCCTGCCCGACCCTCCCGGGCGAGCACCTG
TCGCCGGAGGCCGAGAACCGGCTGCGCAGCGACCTCACCCGTACCCTGCTGGCGCTCGCC
GCCGAACGGCCGGTGCTGATCGGCATCGACGAGTCACACGCGAACGCTTTGTGTCTGCTC
CACCTGGCCCGAAGGGTCGGCTCGGCCCGGATCGCCATGGTCCTCACCGAGTTGCGCCGG
CTCACCCCGGCCCACTCACAGTTCCAGGCCGAGCTGCTCAGCCTGGGGCACCACCGCGAG
ATCGCGCTGCGCCCGCTCAGCCCGAAGCACACCGCCGAGCTGGTCCGCGCCGGTCTCGGT
CCCGACGTCGACGAGGACGTGCTCACGGGGTTGTACCGGGCGACCGGCGGCAACCTGAAC
CTCACCCGCGGACTGATCAACGATGTGCGGGAGGCCTGGGAGACGGGAGGGACGGGCATC
AGCGCGGGCCGCGCGTACCGGCTGGCATACCTCGGTTCCCTCTACCGCTGCGGCCCGGTC
CCGTTGCGGGTCGCACGGGTGGCCGCCGTGCTGGGCCAGAGCGCCAACACCACCCTGGTG
CGCTGGATCAGCGGGCTCAACGCGGACGCGGTGGGCGAGGCAACCGAGATCCTCACCGAA
GGCGGCCTGCTGCACGACCTGCGGTTCCCGCACCCGGCGGCCCGTTCGGTGGTACTCAAC
GACATGTCCGCCCAGGAACGACGCCGCCTGCACCGGTCCGCTCTGGAAGTGCTGGACGAC
GTGCCCGTGGAAGTGGTCGCGCACCACCAGGTCGGCGCCGGTCTCCTGCACGGCCCGAAG
GCCGCCGAGATATTCGCCAAGGCCGGCCAGGAGCTGCATGTGCGCGGCGAGTTGGACACC
GCGTCCGACTATCTGCAACTGGCCCACCAGGCCTCCGACGACGCCGTCACCGGGATGCGG
GCCGAGGCCGTGGCGATCGAGCGCCGCCGCAACCCGCTGGCCTCGAGCCGGCACCTCGAC
GAGCTGACCGTCGTCGCCCGTGCCGGGCTGCTCTTCCCCGAGCACACGGCGCTGATGATC
CGCTGGCTGGGCGTCGGCGGGCGGTCCGGCGAGGCAGCCGGGCTGCTGGCCTCGCAGCGC
CCCCGTGCGGTCACCGACCAGGACAGGGCCCATATGCGGGCCGCCGAGGTATCGCTCGCG
CTGGTCAGCCCCGGCACGTCCGGCCCGGACCGGCGGCCGCGTCCGCTCACGCCGGATGAG
CTCGCGAACCTGCCGAAGGCGGCCCGGCTCTGCGCGATCGCCGACAATGCCGTCATGTCG
GCCCTGCGCGGTCGTCCCGAGCTCGCCGCGGCCGAGGCGGAGAACGTCCTGCAGCACGCC
GACTCGGCGGCGGCCGGCACCACCGCCCTCGCCGCGCTGACCGCCTTGCTGTACGCGGAG
AACACCGACACCGCTCAGCTCTGGGCCGACAAGCTGGTCTCCGAGACCGGGGCGTCGAAC
GAGGAGGAGGCGGGCTACGCGGGGCCGCGCGCCGAAGCCGCGTTGCGTCGCGGCGACCTG
GCCGCGGCGGTCGAGGCAGGCAGCACCGTTCTGGACCACCGGCGGCTCTCGACGCTCGGC
ATCACCGCCGCGCTACCGCTGAGCAGCGCGGTGGCCGCCGCCATCCGGCTGGGCGAGACC
GAGCGGGCGGAGAAGTGGCTCGCCCAGCCGCTGCCGCAGGCCATCCAGGACGGCCTGTTC
GGCCTGCACCTGCTCTCGGCGCGCGGCCAGTACAGCCTCGCCACGGGCCAGCACGAGTCG
GCGTACACGGCGTTTCGCACCTGCGGGGAACGTATGCGGAACTGGGGCGTTGACGTGCCG
GGTCTGTCCCTGTGGCGCGTCGACGCCGCCGAGGCGCTGCTGCACGGCCGCGACCGGGAC
GAGGGCCGACGGCTCGTCGACGAGCAACTCACCCGTGCGATGGGACCCCGTTCCCGCGCC
TTGACGCTGCGGGTGCAGGCGGCGTACAGCCCGCCGGCGAAGCGGGTCGACCTGCTCGAT
GAAGCGGCCGACCTGCTGCTCTCCTGCAACGACCAGTACGAGCGGGCACGGGTGCTCGCC
GACCTGAGCGAGACGTTCAGCGCGCTCCGGCACCACAGCCGGGCGCGGGGACTGCTTCGG
CAGGCCCGGCACCTGGCCGCCCAGCGCGGCGCGATACCGCTGCTGCGCCGACTCGGGGCC
AAGCCCGGAGGCCCCGGCTGGCTGGAGGAATCCGGCCTGCCGCAGCGGATCAAGTCGCTG
ACCGACGCGGAGCGGCGGGTGGCGTCGCTGGCCGCCGGCGGACAGACCAACCGCGTGATC
GCCGACCAGCTCTTCGTCACGGCCAGCACGGTGGAGCAGCACCTCACGGACGTCTCCACT
GGGTCAAGGCCGCCAGCACCTGCCGCCGAACTCGTCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [817-870]  4.39999967439747e-07 SM00421
SM00421   HTH_LUXR
 [818-858]  4e-07 PF00196
PF00196   GerE
IPR011990 Tetratricopeptide-like helical (Domain)
 [490-713]  1.1e-13 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [811-858]  2.9e-11 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [814-858]  5.99999702863249e-08 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit