close all open/close all

CDS information : Rapam_00240


close this sectionLocation

Organism
StrainNRRL 5491
Entry nameRapamycin
Contig
Start / Stop / Direction101,422 / 102,414 / + [in whole cluster]
101,422 / 102,414 / + [in contig]
Location101422..102414 [in whole cluster]
101422..102414 [in contig]
TypeCDS
Length993 bp (330 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
ProductAraC family transcriptional activator
Product (GenBank)helix-turn-helix DNA binding protein
GeneorfG
rapG
Gene (GenBank)orfG
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[7644502] The biosynthetic gene cluster for the polyketide immunosuppressant rapamycin. (Proc Natl Acad Sci U S A. , 1995)
[8635730] Organisation of the biosynthetic gene cluster for rapamycin in Streptomyces hygroscopicus: analysis of genes flanking the polyketide synthase. (Gene. , 1996)
[17468238] Roles of rapH and rapG in positive regulation of rapamycin biosynthesis in Streptomyces hygroscopicus. (J Bacteriol. , 2007)

close this sectionSequence

selected fasta
>AraC family transcriptional activator [helix-turn-helix DNA binding protein]
MTNGAGAEADGSRGAFSVDSTVPGAAPQGFFQAFQRGWDAELGDGLPLRSFNRDVTGDFR
VRSRAAKVRDLAFTDLHSMSAIRTAHALGGVEDRVRMYVVKRGAWTLAGSRDRDRHTVAA
GQFLLRHVGQPWRFEAAPHTTVKILLLPPGPLTPLLGNRAVTGPADSAEVRLLVAHANMV
YETMTGLGPAGVQAAHSTLLELAQSVARRRFDDVEPRLAPALAGAAKDLADSHLTDPELS
PTMLARELNVSLRTLQRAFTVAGESLIAYIRHRRLEEARRALIASAGRLSVSELAAHWQF
ADSSHFIRVFKKTYGQTPTEYARSTGLTDS
selected fasta
>AraC family transcriptional activator [helix-turn-helix DNA binding protein]
ATGACCAACGGCGCTGGAGCGGAGGCCGACGGATCGCGCGGGGCGTTCTCCGTGGACTCC
ACCGTCCCGGGCGCGGCACCACAAGGATTCTTCCAGGCCTTCCAGCGCGGGTGGGACGCG
GAGCTCGGCGACGGCTTGCCGCTGCGGAGCTTCAACCGGGATGTGACCGGTGACTTCCGG
GTCAGGAGCCGCGCCGCCAAGGTCCGCGACCTGGCGTTCACCGATCTCCACAGCATGTCG
GCCATCCGGACCGCACACGCGCTGGGCGGTGTGGAGGACCGGGTACGGATGTACGTCGTG
AAACGCGGCGCATGGACGTTGGCAGGTTCGCGCGATCGGGACCGGCACACCGTGGCGGCC
GGGCAGTTCCTCCTCCGGCACGTCGGGCAGCCGTGGCGCTTCGAGGCGGCGCCGCACACG
ACGGTGAAGATCCTTCTGCTGCCTCCCGGGCCGCTCACCCCACTGCTGGGAAACCGGGCC
GTCACCGGGCCCGCGGATTCGGCCGAGGTACGCCTGCTGGTGGCCCACGCGAATATGGTG
TACGAGACCATGACCGGCCTGGGCCCGGCCGGTGTGCAAGCCGCCCACAGCACCCTGCTC
GAACTGGCCCAGTCGGTGGCGAGGCGTCGGTTCGACGATGTGGAGCCCCGGCTGGCGCCC
GCGCTCGCCGGGGCCGCGAAGGACCTCGCGGACAGCCACCTCACCGACCCCGAGCTCTCC
CCCACGATGCTGGCGCGTGAACTCAACGTCTCCTTACGCACCTTGCAGCGGGCGTTCACC
GTGGCGGGAGAGTCGTTGATCGCCTACATCCGTCACCGGCGGCTGGAAGAGGCCCGCCGC
GCTCTCATCGCCTCGGCCGGCAGGCTGAGCGTCTCGGAACTCGCCGCCCACTGGCAGTTC
GCCGACAGCAGCCACTTCATCCGGGTCTTCAAGAAGACCTACGGCCAGACGCCCACCGAG
TACGCCCGCTCAACCGGGCTGACCGACAGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009057 Homeodomain-like (Domain)
 [225-273]  1.3e-15 G3DSA:1.10.10.60 [274-324]  7.90000000000001e-15 G3DSA:1.10.10.60
G3DSA:1.10.10.60   Homeodomain-rel
 [273-324]  1.29999924468179e-11 SSF46689
SSF46689   Homeodomain_like
IPR018060 DNA binding HTH domain, AraC-type (Domain)
 [238-322]  3.49999466863949e-32 SM00342
SM00342   HTH_ARAC
 [224-324]  PS01124
PS01124   HTH_ARAC_FAMILY_2
IPR018062 HTH domain AraC-type, conserved site (Conserved_site)
 [274-318]  PS00041
PS00041   HTH_ARAC_FAMILY_1
IPR020449 Transcription regulator HTH, AraC- type (Family)
 [291-306]  2.10000037262656e-05 PR00032 [306-322]  2.10000037262656e-05 PR00032
PR00032   HTHARAC
SignalP No significant hit
TMHMM No significant hit