close all open/close all

CDS information : Rapam_00250


close this sectionLocation

Organism
StrainNRRL 5491
Entry nameRapamycin
Contig
Start / Stop / Direction103,788 / 102,427 / - [in whole cluster]
103,788 / 102,427 / - [in contig]
Locationcomplement(102427..103788) [in whole cluster]
complement(102427..103788) [in contig]
TypeCDS
Length1,362 bp (453 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative major facilitator superfamily transporter
Product (GenBank)membrane transport protein
Gene
Gene (GenBank)orfF
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[7644502] The biosynthetic gene cluster for the polyketide immunosuppressant rapamycin. (Proc Natl Acad Sci U S A. , 1995)
[8635730] Organisation of the biosynthetic gene cluster for rapamycin in Streptomyces hygroscopicus: analysis of genes flanking the polyketide synthase. (Gene. , 1996)
Family/Domain
FD
IPR011701

close this sectionSequence

selected fasta
>putative major facilitator superfamily transporter [membrane transport protein]
MSRHSPAPSAWRRIQTAWGLPDLAGKGRFVTANLIDSLGNGLVMAFTVVFFVKTTSLSLV
AVGAALTAGQLLALPVPPFIGSLLDKYGPRIVVAAGNWISVGGFIGFLFSHAAWQIVLWQ
FVVQLGSTAFWMGHSPLIVLVARGVERARWFGFVRALRNVGVGFGGAASAVALSIGTVTW
LRAVMVINVVTFAVAGWLVITFRGADGSGAADAGPAEAKPAEPERAAGEATGQPSGGFRT
VLKDTRYLRLVATNIAFAFASTVVAVLLAVYVADNLAVGSWIVGVLVVLNTVMVALLQTL
ASRWIEARRPAAVLVLALLFNAAAFAVFGTLLVLPGWAVIAGLLIAMVLYTVGEILGSPP
TSELSVVMAPEHLRGRYLGVYQLSWSVGGAVAPALLTALLEGGAALPWVFLTAISVLAVP
LVLGLDRRPAATSEAAPAGDAASVEQLDGGPVG
selected fasta
>putative major facilitator superfamily transporter [membrane transport protein]
ATGTCGCGGCATTCCCCCGCGCCTTCGGCGTGGCGGCGGATTCAGACGGCCTGGGGTCTG
CCGGACCTCGCGGGAAAGGGCCGCTTCGTCACGGCCAATCTGATCGACAGCCTGGGCAAC
GGGTTGGTGATGGCGTTCACCGTCGTCTTCTTCGTGAAGACGACGTCGCTGTCACTGGTC
GCCGTCGGCGCCGCGCTGACCGCCGGACAGCTGCTCGCCCTGCCCGTTCCGCCCTTTATC
GGGTCCCTGTTGGACAAATACGGTCCGCGTATCGTGGTCGCTGCGGGCAACTGGATTTCG
GTGGGCGGATTCATCGGTTTCCTGTTCTCGCACGCGGCCTGGCAGATCGTGCTGTGGCAG
TTCGTGGTGCAACTGGGTTCCACCGCCTTCTGGATGGGCCACAGTCCGCTCATCGTGCTG
GTCGCCCGGGGCGTCGAGCGGGCCCGCTGGTTCGGCTTCGTGCGTGCCCTCCGCAATGTC
GGCGTCGGTTTCGGCGGCGCCGCGTCCGCGGTGGCCCTGAGCATCGGAACCGTCACCTGG
CTGCGGGCGGTGATGGTGATCAACGTGGTCACCTTCGCCGTCGCGGGCTGGCTCGTGATC
ACCTTCCGGGGCGCGGACGGGAGCGGGGCGGCCGATGCCGGCCCCGCGGAGGCGAAGCCC
GCCGAGCCGGAGCGGGCGGCGGGCGAAGCCACCGGACAACCCTCGGGCGGCTTTCGCACC
GTACTGAAGGACACCCGGTATCTGCGGCTGGTCGCGACGAACATCGCCTTCGCCTTCGCC
TCCACGGTGGTCGCGGTGCTGCTCGCCGTCTACGTGGCGGACAACCTCGCTGTCGGCTCC
TGGATCGTCGGCGTGCTCGTCGTGCTGAACACGGTCATGGTCGCGCTGCTCCAGACGCTC
GCCAGCCGGTGGATCGAGGCCCGCAGACCGGCGGCGGTGCTGGTGCTGGCCCTGCTGTTC
AACGCGGCGGCGTTCGCCGTCTTCGGCACGCTGCTCGTGCTGCCCGGCTGGGCGGTGATC
GCCGGGCTGCTGATCGCGATGGTGCTCTACACCGTGGGCGAGATCCTCGGCTCGCCGCCG
ACCAGCGAACTGAGCGTGGTGATGGCGCCCGAGCATCTGCGGGGCCGCTATCTGGGCGTC
TACCAGCTGTCCTGGTCGGTCGGCGGTGCCGTCGCCCCGGCGCTGCTCACAGCGCTGCTG
GAGGGCGGTGCGGCGCTGCCCTGGGTGTTCCTCACCGCGATCAGCGTGCTGGCCGTACCG
CTCGTGCTCGGGCTCGACCGGCGGCCCGCGGCCACGAGCGAGGCCGCACCGGCCGGGGAC
GCCGCCTCCGTGGAGCAACTCGACGGCGGCCCCGTCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011701 Major facilitator superfamily (Family)
 [33-393]  2.2e-23 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-433]  1.99999636034521e-40 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [25-430]  PS50850
PS50850   MFS
SignalP
 [1-1]  Signal-anchor
Eukaryota   
TMHMM
 [30-52]  Transmembrane (o-i) [59-81]  Transmembrane (i-o) [91-113]  Transmembrane (o-i) [151-173]  Transmembrane (i-o) [178-200]  Transmembrane (o-i) [250-272]  Transmembrane (i-o) [276-298]  Transmembrane (o-i) [311-333]  Transmembrane (i-o) [337-356]  Transmembrane (o-i) [377-399]  Transmembrane (i-o) [403-425]  Transmembrane (o-i)
Transmembrane 11