close all open/close all
Rapam_00270 Rapam_00270   last last

CDS information : Rapam_00280


close this sectionLocation

Organism
StrainNRRL 5491
Entry nameRapamycin
Contig
Start / Stop / Direction106,758 / 107,379 / + [in whole cluster]
106,758 / 107,379 / + [in contig]
Location106758..107379 [in whole cluster]
106758..107379 [in contig]
TypeCDS
Length622 bp (206 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.2 function unknown
Productputative pyridoxal phosphate-dependent enzyme(fragment)
Product (GenBank)cystathione synthase
Gene
Gene (GenBank)orfDD
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[7644502] The biosynthetic gene cluster for the polyketide immunosuppressant rapamycin. (Proc Natl Acad Sci U S A. , 1995)
[8635730] Organisation of the biosynthetic gene cluster for rapamycin in Streptomyces hygroscopicus: analysis of genes flanking the polyketide synthase. (Gene. , 1996)
Related Reference
ACC
Q2QD00
PmId
[17225146] Identification of three Zwittermicin A biosynthesis-related genes from Bacillus thuringiensis subsp. kurstaki strain YBT-1520. (Arch Microbiol. , 2007)
[18692050] L-2,3-diaminopropionate: one of the building blocks for the biosynthesis of Zwittermicin A in Bacillus thuringiensis subsp. kurstaki strain YBT-1520. (FEBS Lett. , 2008)
Family/Domain
FD
IPR001926

close this sectionSequence

selected fasta
>putative pyridoxal phosphate-dependent enzyme(fragment) [cystathione synthase]
MGTPLIPLADEQCDIVAKLEFCNPTGSSKDRSALWILEQAIGRGEIARSTTVVESSSGNF
ALALAFYCRMLGISFVPVIDPNCNEATEAQLRLLCERVEKVAIRDGSGSYLKNRLSRVRE
LLVELDSAYWPNQYANPDARDAHYHFTAGELIAQAGPLDYLFVGVGTGGTIAGLSRRIKE
TYPDCVVVAVDAEGSVIFGGPPKKRRI-
selected fasta
>putative pyridoxal phosphate-dependent enzyme(fragment) [cystathione synthase]
ATGGGAACCCCGCTGATTCCTCTGGCGGACGAGCAGTGTGACATCGTCGCGAAGCTGGAA
TTCTGCAATCCCACGGGAAGCAGCAAAGACCGTTCGGCGCTGTGGATTCTGGAACAGGCG
ATCGGCCGCGGGGAGATAGCGCGGAGCACGACGGTGGTCGAGTCCTCGTCCGGCAATTTC
GCGCTGGCCCTGGCCTTCTACTGCCGGATGCTCGGCATCTCGTTCGTCCCGGTCATCGAT
CCGAACTGCAACGAGGCCACCGAGGCCCAGCTCCGGCTGCTGTGCGAGCGGGTGGAGAAA
GTCGCCATCCGTGACGGGTCGGGCAGCTACCTGAAGAACCGGCTGTCCCGGGTCCGGGAA
CTGCTGGTCGAACTCGACTCGGCCTATTGGCCCAACCAGTACGCCAATCCCGATGCCCGC
GACGCGCATTACCACTTCACCGCGGGCGAGCTGATCGCACAGGCCGGCCCGCTGGATTAT
CTCTTCGTCGGCGTGGGCACCGGCGGCACGATCGCCGGGCTCTCCCGCCGGATCAAGGAA
ACCTACCCCGATTGCGTCGTCGTCGCCGTCGACGCCGAAGGCTCGGTGATCTTCGGCGGC
CCGCCGAAGAAGCGGCGGATCC

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001926 Pyridoxal phosphate-dependent enzyme, beta subunit (Domain)
 [2-198]  9.8e-39 PF00291
PF00291   PALP
 [3-207]  1.9e-46 SSF53686
SSF53686   Tryptophan synthase beta subunit-like PLP-dependent enzymes
SignalP No significant hit
TMHMM No significant hit
Rapam_00270 Rapam_00270   last last