close all open/close all

CDS information : Resis_00020


close this sectionLocation

Organism
StrainHKI-237
Entry nameResistomycin
Contig
Start / Stop / Direction1,289 / 840 / - [in whole cluster]
1,289 / 840 / - [in contig]
Locationcomplement(840..1289) [in whole cluster]
complement(840..1289) [in contig]
TypeCDS
Length450 bp (149 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative TetR family transcriptional regulator
Product (GenBank)RemR protein
Gene
Gene (GenBank)remR
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[14982421] A gene cluster encoding resistomycin biosynthesis in Streptomyces resistomycificus; exploring polyketide cyclization beyond linear and angucyclic patterns. (J Am Chem Soc. , 2004)
Family/Domain
FD
IPR001647

close this sectionSequence

selected fasta
>putative TetR family transcriptional regulator [RemR protein]
MNKDRLLSAARQELCRHGFEGTTLRGVAHRAGVDARLVSYYFAGKEQLCSEAVRLPWDSP
AAGRAALAAALTHRPSAVRLSGALGDTLGVMYRGAGARDPDLVAAATASVLLGLTLLSCA
GVPALDPPGPGTTAAVSRYLGSLSEGPSS
selected fasta
>putative TetR family transcriptional regulator [RemR protein]
GTGAACAAGGACCGACTTCTCAGCGCGGCCCGTCAGGAACTGTGCCGGCACGGCTTCGAG
GGGACGACTCTGCGCGGGGTGGCGCACCGGGCGGGGGTGGACGCGCGGCTGGTGAGCTAC
TACTTCGCGGGCAAGGAGCAGTTGTGCTCCGAGGCCGTCCGGCTCCCCTGGGACTCCCCG
GCGGCGGGCCGCGCCGCGCTCGCCGCCGCGCTGACCCACCGGCCCTCCGCGGTCCGGCTG
AGCGGCGCCCTCGGTGACACGCTCGGCGTGATGTACCGCGGCGCGGGGGCGCGGGACCCG
GACCTCGTGGCGGCGGCGACGGCCAGTGTCCTGCTGGGGCTGACGCTGCTGTCCTGCGCG
GGCGTCCCCGCGCTGGATCCGCCCGGGCCAGGGACGACGGCGGCCGTGTCGCGCTACCTC
GGGTCCCTGTCGGAGGGCCCCTCGTCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [6-19]  9.10000425645573e-05 PR00455 [27-50]  9.10000425645573e-05 PR00455
PR00455   HTHTETR
 [6-51]  1.9e-11 PF00440
PF00440   TetR_N
 [1-60]  PS50977
PS50977   HTH_TETR_2
IPR009057 Homeodomain-like (Domain)
 [2-78]  4.39999967439747e-12 SSF46689
SSF46689   Homeodomain_like
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [3-80]  2.4e-17 G3DSA:1.10.357.10
G3DSA:1.10.357.10   TetR_C
SignalP No significant hit
TMHMM
 [102-124]  Transmembrane (i-o)
Transmembrane 1