close all open/close all

CDS information : Resis_00030


close this sectionLocation

Organism
StrainHKI-237
Entry nameResistomycin
Contig
Start / Stop / Direction1,536 / 1,967 / + [in whole cluster]
1,536 / 1,967 / + [in contig]
Location1536..1967 [in whole cluster]
1536..1967 [in contig]
TypeCDS
Length432 bp (143 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productcyclase
Product (GenBank)RemF protein
Gene
Gene (GenBank)remF
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[14982421] A gene cluster encoding resistomycin biosynthesis in Streptomyces resistomycificus; exploring polyketide cyclization beyond linear and angucyclic patterns. (J Am Chem Soc. , 2004)
[18533655] Orchestration of discoid polyketide cyclization in the resistomycin pathway. (J Am Chem Soc. , 2008)
[19665022] The polyketide cyclase RemF from Streptomyces resistomycificus contains an unusual octahedral zinc binding site. (FEBS Lett. , 2009)

close this sectionSequence

selected fasta
>cyclase [RemF protein]
MKRVHRTDVKAEIVREPGAKETTHRKLIDTPDGADRFVLTEFEVSPNGSTPPHFHEWEHE
IYVLEGSMGLVLPDQGRTEEVGPGEAIFIPRGEPHGFVTGPGQTCRFLVVAPCERPPVRN
VFLSEDPYEYTQMPEYTSLLESK
selected fasta
>cyclase [RemF protein]
ATGAAACGAGTGCACCGAACCGACGTGAAGGCAGAAATCGTCAGGGAACCGGGAGCGAAG
GAGACGACGCACCGCAAGCTGATCGACACCCCGGACGGCGCGGACCGCTTCGTCCTCACC
GAGTTCGAGGTGTCGCCGAACGGGTCCACCCCGCCCCACTTCCACGAGTGGGAGCACGAG
ATCTACGTGCTCGAGGGCTCCATGGGCCTGGTCCTGCCCGACCAGGGCCGCACCGAGGAG
GTCGGGCCGGGCGAGGCCATCTTCATCCCCCGGGGCGAGCCGCACGGCTTCGTCACCGGA
CCCGGGCAGACGTGCCGCTTCCTCGTCGTCGCCCCGTGCGAACGGCCGCCGGTGCGCAAC
GTGTTCCTCTCCGAGGACCCCTACGAGTACACGCAGATGCCCGAGTACACCAGCCTCCTG
GAGAGCAAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011051 RmlC-like cupin domain (Domain)
 [1-110]  2.39999798157265e-21 SSF51182
SSF51182   RmlC_like_cupin
IPR013096 Cupin 2, conserved barrel (Domain)
 [42-110]  2.6e-14 PF07883
PF07883   Cupin_2
IPR014710 RmlC-like jelly roll fold (Domain)
 [17-115]  1.2e-24 G3DSA:2.60.120.10
G3DSA:2.60.120.10   RmlC-like_jellyroll
SignalP No significant hit
TMHMM No significant hit