close all open/close all

CDS information : Resis_00040


close this sectionLocation

Organism
StrainHKI-237
Entry nameResistomycin
Contig
Start / Stop / Direction1,964 / 3,013 / + [in whole cluster]
1,964 / 3,013 / + [in contig]
Location1964..3013 [in whole cluster]
1964..3013 [in contig]
TypeCDS
Length1,050 bp (349 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Productdimethyltransferase
Product (GenBank)RemG protein
Gene
Gene (GenBank)remG
EC number2.1.1.-
Keyword
  • C-geminal
Note
Note (GenBank)
Reference
ACC
PmId
[14982421] A gene cluster encoding resistomycin biosynthesis in Streptomyces resistomycificus; exploring polyketide cyclization beyond linear and angucyclic patterns. (J Am Chem Soc. , 2004)
[17914826] Geminal tandem C-methylation in the discoid resistomycin pathway. (J Am Chem Soc. , 2007)

close this sectionSequence

selected fasta
>dimethyltransferase [RemG protein]
MTTTQDLDTQAGQASPDGDSSRVHTILTAYLQSKAVFAALDLGVFEALEKSPRTVAELAD
ELGLEKRPTRALLVALKGLDLVRAENGGYRNSDEASRYLVAGRPEYMGGFAAHQNSHFGH
FSRLDEAVRTNTSLNQRVLKQGYRDQGAAAGEGREGTGRLIQAMRVSSRLQAGKLAAAVP
LAGVRRVVDLGCGSGDYSIALASHHPELRVTALDYPAVTDLARANVREAGLEDRIEVRPA
DIMADAWPETDAVLLSHVLDGYGPERAAHLVKRIHAHLPDGGRLLVHSHMPALATGLFPA
MFGLILLVNTEEGEVRDVDEIRAWVEGAGFRDIATRNVSQLSGLLTATK
selected fasta
>dimethyltransferase [RemG protein]
GTGACGACCACTCAGGACCTCGACACCCAGGCCGGCCAGGCCTCCCCCGACGGCGACTCC
TCCAGGGTCCACACCATCCTGACCGCCTACCTCCAGTCCAAGGCCGTGTTCGCGGCCCTC
GACCTCGGGGTCTTCGAGGCGCTGGAGAAGAGCCCGCGCACGGTGGCCGAACTGGCCGAC
GAACTGGGCCTGGAGAAACGTCCCACCCGCGCCCTGCTCGTCGCCCTCAAGGGCCTGGAC
CTGGTGCGCGCCGAGAACGGCGGCTACCGCAACTCCGACGAGGCGAGCCGCTATCTCGTC
GCCGGGCGGCCCGAGTACATGGGCGGGTTCGCCGCGCACCAGAACTCCCACTTCGGCCAC
TTCTCCCGCCTCGACGAGGCCGTACGCACCAACACCTCGCTCAACCAGCGGGTCCTCAAG
CAGGGTTACCGCGACCAGGGCGCCGCGGCCGGCGAGGGCCGCGAGGGCACCGGGCGGCTC
ATCCAGGCCATGCGGGTCAGCTCCCGGCTGCAGGCGGGCAAGCTGGCCGCCGCGGTCCCG
CTGGCCGGCGTCCGCCGGGTCGTCGACCTGGGCTGCGGCTCGGGCGACTACTCGATCGCC
CTCGCCTCCCACCACCCCGAGCTGCGTGTCACGGCCCTCGACTACCCCGCGGTGACCGAC
CTGGCCCGCGCCAACGTGCGCGAGGCCGGCCTCGAGGACCGGATCGAGGTCAGGCCCGCC
GACATCATGGCGGACGCCTGGCCGGAGACGGACGCGGTCCTCCTCTCCCACGTCCTCGAC
GGCTACGGCCCCGAGCGCGCCGCGCACCTGGTCAAGCGCATCCACGCCCATCTGCCCGAC
GGCGGAAGGCTGTTGGTGCACTCCCACATGCCGGCCCTGGCCACCGGCCTCTTCCCGGCC
ATGTTCGGGCTGATCCTCCTGGTCAACACCGAGGAGGGCGAGGTCCGGGACGTGGACGAG
ATCCGCGCCTGGGTGGAGGGCGCCGGGTTCCGGGACATCGCCACCCGCAACGTCTCCCAG
CTCTCCGGTCTGCTCACGGCCACCAAGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001077 O-methyltransferase, family 2 (Domain)
 [93-325]  2.7e-26 PF00891
PF00891   Methyltransf_2
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [21-95]  1.3e-20 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016461 O-methyltransferase, caffeic acid-type (Family)
 [1-349]  1.30000067202732e-05 PIRSF005739
PIRSF005739   O-mtase
SignalP No significant hit
TMHMM No significant hit